Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of KREMEN2 expression in transfected 293T cell line by KREMEN2 polyclonal antibody. Lane1: KREMEN2 transfected lysate (46.2kD). Lane2: Non-transfected lysate.)

Mouse anti-Human KREMEN2 Polyclonal Antibody | anti-KREMEN2 antibody

KREMEN2 (KRM2, Kremen Protein 2, Dickkopf Receptor 2, Kringle Domain-containing Transmembrane Protein 2, Kringle-containing Protein Marking the Eye and the Nose, MGC10791, MGC16709)

Gene Names
KREMEN2; KRM2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
KREMEN2; Polyclonal Antibody; KREMEN2 (KRM2; Kremen Protein 2; Dickkopf Receptor 2; Kringle Domain-containing Transmembrane Protein 2; Kringle-containing Protein Marking the Eye and the Nose; MGC10791; MGC16709); Anti -KREMEN2 (KRM2; anti-KREMEN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KREMEN2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPGAPPAAIGGAVCWLREKGPRRWGLPGAPGEAGLCGTNSPEGWPCPAPPGTPRLRVLPRATGL
Applicable Applications for anti-KREMEN2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human KREMEN2, aa1-420 (NP_078783.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KREMEN2 expression in transfected 293T cell line by KREMEN2 polyclonal antibody. Lane1: KREMEN2 transfected lysate (46.2kD). Lane2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KREMEN2 expression in transfected 293T cell line by KREMEN2 polyclonal antibody. Lane1: KREMEN2 transfected lysate (46.2kD). Lane2: Non-transfected lysate.)
Related Product Information for anti-KREMEN2 antibody
This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein forms a ternary membrane complex with DKK1 and the WNT receptor lipoprotein receptor-related protein 6 (LRP6), and induces rapid endocytosis and removal of LRP6 from the plasma membrane. It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.
Product Categories/Family for anti-KREMEN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
48,849 Da
NCBI Official Full Name
KREMEN2 protein
NCBI Official Synonym Full Names
kringle containing transmembrane protein 2
NCBI Official Symbol
KREMEN2
NCBI Official Synonym Symbols
KRM2
NCBI Protein Information
kremen protein 2; dickkopf receptor 2; kringle domain-containing transmembrane protein 2; kringle-containing protein marking the eye and the nose
UniProt Protein Name
Kremen protein 2
Protein Family
UniProt Gene Name
KREMEN2
UniProt Synonym Gene Names
KRM2
UniProt Entry Name
KREM2_HUMAN

NCBI Description

This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor. A similar protein in mouse functions interacts with with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein forms a ternary membrane complex with DKK1 and the WNT receptor lipoprotein receptor-related protein 6 (LRP6), and induces rapid endocytosis and removal of LRP6 from the plasma membrane. It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

KREMEN2: Receptor for Dickkopf protein. Cooperates with Dickkopf to block Wnt/beta-catenin signaling. Forms a ternary complex with Dkk1 and LRP6 and induces rapid endocytosis and removal of the Wnt receptor LRP6 from the plasma membrane. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: membrane; early endosome membrane; plasma membrane; integral to membrane

Biological Process: Wnt receptor signaling pathway; cell communication

Research Articles on KREMEN2

Similar Products

Product Notes

The KREMEN2 kremen2 (Catalog #AAA6007733) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KREMEN2 (KRM2, Kremen Protein 2, Dickkopf Receptor 2, Kringle Domain-containing Transmembrane Protein 2, Kringle-containing Protein Marking the Eye and the Nose, MGC10791, MGC16709) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KREMEN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the KREMEN2 kremen2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGTQALQGFL FLLFLPLLQP RGASAGSLHS PGLSECFQVN GADYRGHQNR TGPRGAGRPC LFWDQTQQHS YSSASDPHGR WGLGAHNFCR NPDGDVQPWC YVAETEEGIY WRYCDIPSCH MPGYLGCFVD SGAPPALSGP SGTSTKLTVQ VCLRFCRMKG YQLAGVEAGY ACFCGSESDL ARGRLAPATD CDQICFGHPG QLCGGDGRLG VYEVSVGSCQ GNWTAPQGVI YSPDFPDEYG PDRNCSWALG PPGAALELTF RLFELADPRD RLELRDAASG SLLRAFDGAR PPPSGPLRLG TAALLLTFRS DARGHAQGFA LTYRGLQDAA EDPEAPEGSA QTPAAPLDGA NVSCSPRPGA PPAAIGGAVC WLREKGPRRW GLPGAPGEAG LCGTNSPEGW PCPAPPGTPR LRVLPRATGL. It is sometimes possible for the material contained within the vial of "KREMEN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.