Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KREMEN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

Rabbit KREMEN1 Polyclonal Antibody | anti-KREMEN1 antibody

KREMEN1 antibody - N-terminal region

Gene Names
KREMEN1; KRM1; ECTD13; KREMEN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KREMEN1; Polyclonal Antibody; KREMEN1 antibody - N-terminal region; anti-KREMEN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQR
Sequence Length
475
Applicable Applications for anti-KREMEN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KREMEN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KREMEN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-KREMEN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)
Related Product Information for anti-KREMEN1 antibody
This is a rabbit polyclonal antibody against KREMEN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. It is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains.This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.
Product Categories/Family for anti-KREMEN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
kremen protein 1 isoform 3
NCBI Official Synonym Full Names
kringle containing transmembrane protein 1
NCBI Official Symbol
KREMEN1
NCBI Official Synonym Symbols
KRM1; ECTD13; KREMEN
NCBI Protein Information
kremen protein 1
UniProt Protein Name
Kremen protein 1
Protein Family
UniProt Gene Name
KREMEN1
UniProt Synonym Gene Names
KREMEN; KRM1
UniProt Entry Name
KREM1_HUMAN

NCBI Description

This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

KREMEN1: Receptor for Dickkopf protein. Cooperates with Dickkopf to block Wnt/beta-catenin signaling. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 22q12.1

Cellular Component: membrane; integral to membrane

Molecular Function: protein binding

Biological Process: Wnt receptor signaling pathway; cell communication

Research Articles on KREMEN1

Similar Products

Product Notes

The KREMEN1 kremen1 (Catalog #AAA3207574) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KREMEN1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KREMEN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KREMEN1 kremen1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WKYCEIPACQ MPGNLGCYKD HGNPPPLTGT SKTSNKLTIQ TCISFCRSQR. It is sometimes possible for the material contained within the vial of "KREMEN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.