Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KLRD1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellKLRD1 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)

Rabbit anti-Human, Mouse KLRD1 Polyclonal Antibody | anti-KLRD1 antibody

KLRD1 antibody - middle region

Gene Names
KLRD1; CD94
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KLRD1; Polyclonal Antibody; KLRD1 antibody - middle region; anti-KLRD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSS
Sequence Length
179
Applicable Applications for anti-KLRD1 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KLRD1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellKLRD1 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)

Western Blot (WB) (WB Suggested Anti-KLRD1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellKLRD1 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)
Related Product Information for anti-KLRD1 antibody
This is a rabbit polyclonal antibody against KLRD1. It was validated on Western Blot

Target Description: Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-KLRD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
natural killer cells antigen CD94 isoform 1
NCBI Official Synonym Full Names
killer cell lectin like receptor D1
NCBI Official Symbol
KLRD1
NCBI Official Synonym Symbols
CD94
NCBI Protein Information
natural killer cells antigen CD94
UniProt Protein Name
Natural killer cells antigen CD94
UniProt Gene Name
KLRD1
UniProt Synonym Gene Names
CD94
UniProt Entry Name
KLRD1_HUMAN

NCBI Description

Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2017]

Uniprot Description

KLRD1: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: integral to membrane; plasma membrane; receptor complex; external side of plasma membrane

Molecular Function: protein binding; transmembrane receptor activity; carbohydrate binding

Biological Process: regulation of immune response; cell surface receptor linked signal transduction; natural killer cell mediated immunity; innate immune response

Research Articles on KLRD1

Similar Products

Product Notes

The KLRD1 klrd1 (Catalog #AAA3215958) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLRD1 antibody - middle region reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KLRD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLRD1 klrd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CQEKWVGYRC NCYFISSEQK TWNESRHLCA SQKSSLLQLQ NTDELDFMSS. It is sometimes possible for the material contained within the vial of "KLRD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.