Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human CD94/Natural Killer Cells Antigen CD94 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

CD94/Natural Killer Cells Antigen CD94 Recombinant Protein | CD94 recombinant protein

Recombinant Human CD94/Natural Killer Cells Antigen CD94 Protein

Gene Names
KLRD1; CD94
Purity
>95% by SDS-PAGE.
Synonyms
CD94/Natural Killer Cells Antigen CD94; Recombinant Human CD94/Natural Killer Cells Antigen CD94 Protein; Natural killer cells antigen CD94; KP43; Killer cell lectin-like receptor subfamily D member 1; NKcell receptor; CD94; KLRD1; CD94 recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
SFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Sequence Length
179
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CD94/Natural Killer Cells Antigen CD94 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human CD94/Natural Killer Cells Antigen CD94 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for CD94 recombinant protein
Description: Recombinant Human CD94/Natural Killer Cells Antigen CD94 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ser34-Ile179) of human CD94/Natural Killer Cells Antigen CD94 (Accession #Q13241) fused with a 6xHis tag at the N-terminus.

Background: CD94 (Cluster of Differentiation 94), also known as killer cell lectin-like receptor subfamily D member 1(KLRD1), is expressed on the surface of natural killer cells in the innate immune system. CD94 Plays a role as areceptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. CD94 Canform disulfide-bonded heterodimer with NKG2 family members. The CD94/NKG2 complex, on the surface ofnatural killer cells interacts with Human Leukocyte Antigen (HLA)-E on target cells. Natural killer (NK) cells are adistinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immunestimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, areexpressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigenpreferentially expressed on NK cells and is classified as a type II membrane protein because it has an external Cterminus.
Product Categories/Family for CD94 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Natural killer cells antigen CD94
NCBI Official Synonym Full Names
killer cell lectin like receptor D1
NCBI Official Symbol
KLRD1
NCBI Official Synonym Symbols
CD94
NCBI Protein Information
natural killer cells antigen CD94
UniProt Protein Name
Natural killer cells antigen CD94
UniProt Gene Name
KLRD1
UniProt Synonym Gene Names
CD94
UniProt Entry Name
KLRD1_HUMAN

NCBI Description

Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2017]

Uniprot Description

KLRD1: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: integral to membrane; plasma membrane; receptor complex; external side of plasma membrane

Molecular Function: protein binding; transmembrane receptor activity; carbohydrate binding

Biological Process: regulation of immune response; cell surface receptor linked signal transduction; natural killer cell mediated immunity; innate immune response

Research Articles on CD94

Similar Products

Product Notes

The CD94 klrd1 (Catalog #AAA9139999) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SFTKLSIEPA FTPGPNIELQ KDSDCCSCQE KWVGYRCNCY FISSEQKTWN ESRHLCASQK SSLLQLQNTD ELDFMSSSQQ FYWIGLSYSE EHTAWLWENG SALSQYLFPS FETFNTKNCI AYNPNGNALD ESCEDKNRYI CKQQLI. It is sometimes possible for the material contained within the vial of "CD94/Natural Killer Cells Antigen CD94, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.