Western Blot (WB)
(WB Suggested Anti-KLHL15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Rabbit KLHL15 Polyclonal Antibody | anti-KLHL15 antibody
KLHL15 antibody - middle region
Gene Names
KLHL15; HEL-S-305
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KLHL15; Polyclonal Antibody; KLHL15 antibody - middle region; anti-KLHL15 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC
Sequence Length
604
Applicable Applications for anti-KLHL15 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KLHL15
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-KLHL15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-KLHL15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-KLHL15 antibody
This is a rabbit polyclonal antibody against KLHL15. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.
Target Description: KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.
Product Categories/Family for anti-KLHL15 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
kelch-like protein 15
NCBI Official Synonym Full Names
kelch like family member 15
NCBI Official Symbol
KLHL15
NCBI Official Synonym Symbols
HEL-S-305
NCBI Protein Information
kelch-like protein 15
UniProt Protein Name
Kelch-like protein 15
Protein Family
UniProt Gene Name
KLHL15
UniProt Synonym Gene Names
KIAA1677
UniProt Entry Name
KLH15_HUMAN
NCBI Description
This gene encodes a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. The encoded protein may be involved in protein ubiquitination and cytoskeletal organization. [provided by RefSeq, Apr 2009]
Uniprot Description
KLHL15: a substrate-specific adapter for the recruitment of substrates to Cul3-based E3 ubiquitin ligases. KLHL15-Cul3 specifically targets the PP2A regulatory subunit PPP2R5B to promote its turnover by ubiquitylation and proteasomal degradation. May contribute to the selective expression of the PP2A/B holoenzyme in the brain.
Protein type: Ubiquitin conjugating system
Chromosomal Location of Human Ortholog: Xp22.1-p21
Biological Process: protein ubiquitination
Research Articles on KLHL15
Similar Products
Product Notes
The KLHL15 klhl15 (Catalog #AAA3213915) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLHL15 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KLHL15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLHL15 klhl15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLDKQIMVLG GLCYNGHYSD SILTFDPDEN KWKEDEYPRM PCKLDGLQVC. It is sometimes possible for the material contained within the vial of "KLHL15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
