Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KLF1Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse KLF1 Polyclonal Antibody | anti-KLF1 antibody

KLF1 Antibody-C-terminal region

Gene Names
Klf7; 9830124P08Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KLF1; Polyclonal Antibody; KLF1 Antibody-C-terminal region; Krueppel-like factor 7; 9830124P08Rik; anti-KLF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
KAHLRTHTGEKPYACSWDGCDWRFARSDELTRHYRKHTGHRPFCCGLCPR
Applicable Applications for anti-KLF1 antibody
Western Blot (WB)
Protein Size
301 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse KLF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KLF1Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KLF1Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KLF1 antibody
Description of Target: Transcriptional activator. Binds specifically to an Ikaros core binding element that is crucial for in vivo NTRK1/TrkA enhancer function.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,337 Da
NCBI Official Full Name
Krueppel-like factor 7
NCBI Official Synonym Full Names
Kruppel-like factor 7 (ubiquitous)
NCBI Official Symbol
Klf7
NCBI Official Synonym Symbols
9830124P08Rik
NCBI Protein Information
Krueppel-like factor 7
UniProt Protein Name
Krueppel-like factor 7
Protein Family
UniProt Gene Name
Klf7
UniProt Entry Name
KLF7_MOUSE

Uniprot Description

KLF7: Transcriptional activator. Binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: DNA-binding; C2H2-type zinc finger protein

Cellular Component: nucleus

Molecular Function: nucleic acid binding; DNA binding; metal ion binding; transcription factor activity

Biological Process: axon guidance; regulation of transcription, DNA-dependent; transcription, DNA-dependent; axonogenesis; positive regulation of transcription, DNA-dependent; dendrite morphogenesis

Research Articles on KLF1

Similar Products

Product Notes

The KLF1 klf7 (Catalog #AAA3249710) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLF1 Antibody-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KLF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLF1 klf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KAHLRTHTGE KPYACSWDGC DWRFARSDEL TRHYRKHTGH RPFCCGLCPR. It is sometimes possible for the material contained within the vial of "KLF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.