Immunohistochemistry (IHC)
(Human Muscle )
Rabbit KIFC2 Polyclonal Antibody | anti-KIFC2 antibody
KIFC2 antibody - N-terminal region
Reactivity
Cow, Horse, Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
KIFC2; Polyclonal Antibody; KIFC2 antibody - N-terminal region; anti-KIFC2 antibody
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE
Sequence Length
838
Applicable Applications for anti-KIFC2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Horse: 86%; Human: 100%; Mouse: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KIFC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Muscle )
Immunohistochemistry (IHC)
(Human Muscle )
Western Blot (WB)
(WB Suggested Anti-KIFC2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-KIFC2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-KIFC2 antibody
This is a rabbit polyclonal antibody against KIFC2. It was validated on Western Blot and immunohistochemistry
Target Description: Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division.
Target Description: Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division.
Product Categories/Family for anti-KIFC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
kinesin-like protein KIFC2
NCBI Official Synonym Full Names
kinesin family member C2
NCBI Official Symbol
KIFC2
NCBI Protein Information
kinesin-like protein KIFC2
UniProt Protein Name
Kinesin-like protein KIFC2
Protein Family
UniProt Gene Name
KIFC2
UniProt Entry Name
KIFC2_HUMAN
Research Articles on KIFC2
1. expression level of KIF2C mRNA could be a potential independent marker to evaluate patient prognosis
Similar Products
Product Notes
The KIFC2 kifc2 (Catalog #AAA3201801) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIFC2 antibody - N-terminal region reacts with Cow, Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KIFC2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the KIFC2 kifc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRPPSPDGST SQEESPSHFT AVPGEPLGDE TQGQQPLQLE EDQRAWQRLE. It is sometimes possible for the material contained within the vial of "KIFC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
