Western Blot (WB)
(KIAA1430 antibody (MBS839075) used at 1 ug/ml to detect target protein.)
Rabbit KIAA1430 Polyclonal Antibody | anti-KIAA1430 antibody
KIAA1430 antibody
Gene Names
CFAP97; hmw; KIAA1430
Applications
Western Blot
Purity
Affinity purified
Synonyms
KIAA1430; Polyclonal Antibody; KIAA1430 antibody; Polyclonal KIAA1430; Anti-KIAA1430; DKFZp434F1728; KIAA 1430; FLJ21225; KIAA-1430; Kiaa1430; anti-KIAA1430 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
KIAA1430 antibody was raised against the middle region of KIAA1430
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1430 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
453
Applicable Applications for anti-KIAA1430 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of KIAA1430 protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human
Immunogen
KIAA1430 antibody was raised using the middle region of KIAA1430 corresponding to a region with amino acids NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(KIAA1430 antibody (MBS839075) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(KIAA1430 antibody (MBS839075) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-KIAA1430 antibody
Rabbit polyclonal KIAA1430 antibody raised against the middle region of KIAA1430
Product Categories/Family for anti-KIAA1430 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
59 kDa (MW of target protein)
NCBI Official Full Name
KIAA1430
NCBI Official Synonym Full Names
cilia and flagella associated protein 97
NCBI Official Symbol
CFAP97
NCBI Official Synonym Symbols
hmw; KIAA1430
NCBI Protein Information
cilia- and flagella-associated protein 97
UniProt Protein Name
Cilia- and flagella-associated protein 97
UniProt Gene Name
CFAP97
UniProt Entry Name
CFA97_HUMAN
Uniprot Description
CFAP97: Belongs to the UPF0501 family. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 4q35.1
Similar Products
Product Notes
The KIAA1430 cfap97 (Catalog #AAA839075) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KIAA1430 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KIAA1430 cfap97 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIAA1430, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
