Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KIAA1189 antibody (MBS5301889) used at 1 ug/ml to detect target protein.)

Rabbit KIAA1189 Polyclonal Antibody | anti-KIAA1189 antibody

KIAA1189 antibody

Gene Names
ERMN; JN; ermin; KIAA1189
Applications
Western Blot
Purity
Affinity purified
Synonyms
KIAA1189; Polyclonal Antibody; KIAA1189 antibody; Polyclonal KIAA1189; Anti-KIAA1189; KIAA 1189; ermin; KIAA-1189; anti-KIAA1189 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
KIAA1189 antibody was raised against the middle region of Kiaa1189
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1189 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
284
Applicable Applications for anti-KIAA1189 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of KIAA1189 protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human
Immunogen
KIAA1189 antibody was raised using the middle region of Kiaa1189 corresponding to a region with amino acids RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(KIAA1189 antibody (MBS5301889) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (KIAA1189 antibody (MBS5301889) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-KIAA1189 antibody
Rabbit polyclonal KIAA1189 antibody raised against the middle region of Kiaa1189
Product Categories/Family for anti-KIAA1189 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
34 kDa (MW of target protein)
NCBI Official Full Name
KIAA1189
NCBI Official Synonym Full Names
ermin, ERM-like protein
NCBI Official Symbol
ERMN
NCBI Official Synonym Symbols
JN; ermin; KIAA1189
NCBI Protein Information
ermin
UniProt Protein Name
Ermin
UniProt Gene Name
ERMN
UniProt Synonym Gene Names
KIAA1189; JN
UniProt Entry Name
ERMIN_HUMAN

Uniprot Description

ERMN: Plays a role in cytoskeletal rearrangements during the late wrapping and/or compaction phases of myelinogenesis as well as in maintenance and stability of myelin sheath in the adult. May play an important role in late-stage oligodendroglia maturation, myelin/Ranvier node formation during CNS development, and in the maintenance and plasticity of related structures in the mature CNS. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 2q24.1

Cellular Component: internode region of axon; cytoskeleton; cell soma; paranode region of axon; cytoplasm; cell cortex; myelin sheath; filopodium

Molecular Function: actin filament binding

Biological Process: regulation of cell shape; actin filament organization; morphogenesis of a branching structure; regulation of cell projection organization and biogenesis

Research Articles on KIAA1189

Similar Products

Product Notes

The KIAA1189 ermn (Catalog #AAA5301889) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KIAA1189 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KIAA1189 ermn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIAA1189, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.