Western Blot (WB)
(KIAA1333 antibody (MBS5301983) used at 0.5 ug/ml to detect target protein.)
Rabbit KIAA1333 Polyclonal Antibody | anti-KIAA1333 antibody
KIAA1333 antibody
Gene Names
G2E3; PHF7B; KIAA1333
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
KIAA1333; Polyclonal Antibody; KIAA1333 antibody; Polyclonal KIAA1333; Anti-KIAA1333; G2E3; KIAA 1333; Kiaa1333; KIAA-1333; FLJ20333; anti-KIAA1333 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
KIAA1333 antibody was raised against the N terminal of KIAA1333
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1333 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
706
Applicable Applications for anti-KIAA1333 antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
KIAA1333 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
KIAA1333 antibody was raised using the N terminal of KIAA1333 corresponding to a region with amino acids IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(KIAA1333 antibody (MBS5301983) used at 0.5 ug/ml to detect target protein.)
Western Blot (WB)
(KIAA1333 antibody (MBS5301983) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-KIAA1333 antibody
Rabbit polyclonal KIAA1333 antibody raised against the N terminal of KIAA1333
Product Categories/Family for anti-KIAA1333 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
80 kDa (MW of target protein)
NCBI Official Full Name
KIAA1333
NCBI Official Synonym Full Names
G2/M-phase specific E3 ubiquitin protein ligase
NCBI Official Symbol
G2E3
NCBI Official Synonym Symbols
PHF7B; KIAA1333
NCBI Protein Information
G2/M phase-specific E3 ubiquitin-protein ligase
UniProt Protein Name
G2/M phase-specific E3 ubiquitin-protein ligase
UniProt Gene Name
G2E3
UniProt Synonym Gene Names
KIAA1333
UniProt Entry Name
G2E3_HUMAN
Uniprot Description
G2E3: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Essential in early embryonic development to prevent apoptotic death.
Protein type: Nucleolus; Ubiquitin conjugating system; Ligase; EC 6.3.2.-
Chromosomal Location of Human Ortholog: 14q12
Cellular Component: cytoplasm; nucleolus
Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity
Biological Process: blastocyst development; protein polyubiquitination; apoptosis
Research Articles on KIAA1333
Similar Products
Product Notes
The KIAA1333 g2e3 (Catalog #AAA5301983) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIAA1333 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIAA1333 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the KIAA1333 g2e3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIAA1333, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
