Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KIAA0427 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Rabbit KIAA0427 Polyclonal Antibody | anti-CTIF antibody

KIAA0427 antibody - N-terminal region

Gene Names
CTIF; Gm672; KIAA0427
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KIAA0427; Polyclonal Antibody; KIAA0427 antibody - N-terminal region; anti-CTIF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN
Sequence Length
598
Applicable Applications for anti-CTIF antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0427
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KIAA0427 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-KIAA0427 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Related Product Information for anti-CTIF antibody
This is a rabbit polyclonal antibody against KIAA0427. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of KIAA0427 remains unknown.
Product Categories/Family for anti-CTIF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
CBP80/20-dependent translation initiation factor isoform 1
NCBI Official Synonym Full Names
cap binding complex dependent translation initiation factor
NCBI Official Symbol
CTIF
NCBI Official Synonym Symbols
Gm672; KIAA0427
NCBI Protein Information
CBP80/20-dependent translation initiation factor
UniProt Protein Name
CBP80/20-dependent translation initiation factor
UniProt Gene Name
CTIF
UniProt Synonym Gene Names
KIAA0427
UniProt Entry Name
CTIF_HUMAN

NCBI Description

CTIF is a component of the CBP80 (NCBP1; MIM 600469)/CBP20 (NCBP2; MIM 605133) translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step that recognizes premature termination codons (PTCs) in mRNAs and directs PTC-containing mRNAs toward nonsense-mediated decay (NMD). On mRNAs without PTCs, the CBP80/CBP20 complex is replaced with cytoplasmic mRNA cap-binding proteins, including EIF4G (MIM 600495), and steady-state translation of the mRNAs resumes in the cytoplasm (Kim et al., 2009 [PubMed 19648179]).[supplied by OMIM, Dec 2009]

Research Articles on CTIF

Similar Products

Product Notes

The CTIF ctif (Catalog #AAA3205473) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIAA0427 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's KIAA0427 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTIF ctif for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QVQGLLADKT EGDGESERTQ SHISQWTADC SEPLDSSCSF SRGRAPPQQN. It is sometimes possible for the material contained within the vial of "KIAA0427, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.