Rabbit anti-Human KIAA0319 Polyclonal Antibody | anti-KIAA0319 antibody

KIAA0319 (Dyslexia-associated Protein KIAA0319, DLX2, DYLX2, MGC176717) (MaxLight 550)

Cat. Num. AAA6400940

• Reactivity: Human
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KIAA0319; Polyclonal Antibody; KIAA0319 (Dyslexia-associated Protein KIAA0319; DLX2; DYLX2; MGC176717) (MaxLight 550); anti-KIAA0319 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human KIAA0319.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

• Applicable Applications for anti-KIAA0319 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IHC: 4-8ug/ml; WB: 1.25ug/ml; Applications are based on unconjugated antibody.
• Immunogen: N-terminus of KIAA0319 corresponding to EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG
• Conjugate: MaxLight550
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(KIAA0319 antibody used at 1.25ug/ml to detect target protein.)

Immunohistochemistry (IHC)

(KIAA0319 antibody was used for immunohistochemistry at a concentration of 4-8ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

Immunohistochemistry (IHC)

(KIAA0319 antibody was used for immunohistochemistry at a concentration of 4-8ug/ml. Magnification is at 400X)

Product Categories/Family for anti-KIAA0319 antibody

Antibodies; Neuroscience