Rabbit anti-Human KHDRBS1 Polyclonal Antibody | anti-KHDRBS1 antibody

KHDRBS1 Antibody - middle region

Cat. Num. AAA3223375

• Gene Names: KHDRBS1; p62; p68; Sam68
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: KHDRBS1; Polyclonal Antibody; KHDRBS1 Antibody - middle region; anti-KHDRBS1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVG
• Sequence Length: 443

• Applicable Applications for anti-KHDRBS1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KHDRBS1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KHDRBS1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-KHDRBS1 antibody

This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants.

Product Categories/Family for anti-KHDRBS1 antibody

Polyclonal; Cancer; RNA Binding Proteins; Transcription Regulation; Cell Cycle Proteins; Immunology; Signal Transduction; Meiosis/Mitosis/Cell Cycle

NCBI and Uniprot Product Information

• NCBI GI #: 428673536
• NCBI GeneID: 10657
• NCBI Accession #: NP_001258807.1
• NCBI GenBank Nucleotide #: NM_001271878.1
• UniProt Accession #: Q07666
• Molecular Weight: 48 kDa
• NCBI Official Full Name: KH domain-containing, RNA-binding, signal transduction-associated protein 1 isoform 2
• NCBI Official Synonym Full Names: KH RNA binding domain containing, signal transduction associated 1
• NCBI Official Symbol: KHDRBS1
• NCBI Official Synonym Symbols: p62; p68; Sam68
• NCBI Protein Information: KH domain-containing, RNA-binding, signal transduction-associated protein 1
• UniProt Protein Name: KH domain-containing, RNA-binding, signal transduction-associated protein 1
• Protein Family: KH domain-containing, RNA-binding, signal transduction-associated protein
• UniProt Gene Name: KHDRBS1
• UniProt Synonym Gene Names: Sam68
• UniProt Entry Name: KHDR1_HUMAN

NCBI Description

This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]

Uniprot Description

KHDRBS1: a nuclear RNA-binding protein. May be involved in slicing and mRNA transport. Associates with src in mitosis. Binds to RNA via a heteronuclear ribonucleoprotein K homology domain. Exerts functionally separable effects on cell proliferation and survival, dependent on its ability to bind specifically to RNA.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 1p32

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleus

Molecular Function: identical protein binding; protein binding; SH3/SH2 adaptor activity; DNA binding; RNA binding; protein complex binding; poly(U) binding; SH3 domain binding; poly(A) binding

Biological Process: transcription, DNA-dependent; positive regulation of signal transduction; positive regulation of RNA export from nucleus; regulation of protein stability; signal transduction; positive regulation of translational initiation; cell proliferation; cell surface receptor linked signal transduction; regulation of RNA export from nucleus; mRNA processing; cell cycle arrest; G2/M transition of mitotic cell cycle; negative regulation of transcription, DNA-dependent