Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

Rabbit Keratin 10 (KRT10) Polyclonal Antibody | anti-KRT10 antibody

Polyclonal Antibody to Keratin 10 (KRT10)

Gene Names
Krt10; Ka10
Reactivity
Rat
Applications
Immunocytochemistry, Immunohistochemistry, ELISA, Western Blot
Purity
Affinity Chromatography
Synonyms
Keratin 10 (KRT10); Polyclonal Antibody; Polyclonal Antibody to Keratin 10 (KRT10); anti-KRT10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against KRT10. It has been selected for its ability to recognize KRT10 in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with N-terminal His-Tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-LNNM RNQYEQLAEK NRKDAEAWFN EKSKELTTEI DSNIEQMSSH KSEITELRRT VQGLEIELQS QLALKQSLEA SLAETEGRYC VQLSQIQSQI SALEEQLQQI RAETECQNAE YQQLLDIKTR LENEIQTYRS LLEGE
Sequence Length
584
Applicable Applications for anti-KRT10 antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB)
Application Notes
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Immunogen
Recombinant KRT10 (Leu317~Glu455) expressed in E.coli.
Cross Reactivity
Rat
Conjugated Antibody
The APC conjugated antibody version of this item is also available as catalog #MBS2057975
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Western Blot (WB)

(Western Blot: Sample: Recombinant protein.)

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

Immunohistochemistry (IHC)

(DABstainingonIHC-P.Samples:RatTissue))

Immunohistochemistry (IHC) (DABstainingonIHC-P.Samples:RatTissue))

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,505 Da
NCBI Official Full Name
keratin, type I cytoskeletal 10
NCBI Official Synonym Full Names
keratin 10
NCBI Official Symbol
Krt10
NCBI Official Synonym Symbols
Ka10
NCBI Protein Information
keratin, type I cytoskeletal 10
UniProt Protein Name
Keratin, type I cytoskeletal 10
Protein Family
UniProt Gene Name
Krt10
UniProt Synonym Gene Names
CK-10; K10

Uniprot Description

K10: a type I cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. There are two types of cytoskeletal and microfibrillar keratin: type I (acidic; 40-55 kDa) [K9 to K20] and type II (neutral to basic; 56-70 kDa) [K1 to K8]. Both a basic and an acidic keratin are required for filament assembly. Generally associates with K1.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 10q31

Cellular Component: cornified envelope; cytoplasm; extracellular space; intermediate filament; keratin filament; membrane; nucleus

Molecular Function: cytoskeletal protein binding; structural constituent of epidermis; structural molecule activity

Biological Process: epidermis development; epithelial cell differentiation; intermediate filament organization; keratinocyte differentiation; peptide cross-linking

Similar Products

Product Notes

The KRT10 krt10 (Catalog #AAA2007207) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Keratin 10 (KRT10) reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Keratin 10 (KRT10) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the KRT10 krt10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with N-terminal His-Tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-LNNM RNQYEQLAEK NRKDAEAWFN EKSKELTTEI DSNIEQMSSH KSEITELRRT VQGLEIELQS QLALKQSLEA SLAETEGRYC VQLSQIQSQI SALEEQLQQI RAETECQNAE YQQLLDIKTR LENEIQTYRS LLEGE. It is sometimes possible for the material contained within the vial of "Keratin 10 (KRT10), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.