Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KDM5BSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human KDM5B Polyclonal Antibody | anti-KDM5B antibody

KDM5B Antibody - C-terminal region

Gene Names
KDM5B; CT31; PLU1; PUT1; MRT65; PLU-1; JARID1B; PPP1R98; RBP2-H1; RBBP2H1A
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KDM5B; Polyclonal Antibody; KDM5B Antibody - C-terminal region; anti-KDM5B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQ
Sequence Length
1544
Applicable Applications for anti-KDM5B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KDM5B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KDM5BSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KDM5BSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KDM5B antibody
This is a rabbit polyclonal antibody against KDM5B. It was validated on Western Blot

Target Description: KDM5B is a histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. It does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. KDM5B demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. It acts as a transcriptional corepressor for FOXG1B and PAX9. It favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, KDM5B may act as a tumor suppressor for melanoma.
Product Categories/Family for anti-KDM5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
169kDa
NCBI Official Full Name
lysine-specific demethylase 5B isoform 2
NCBI Official Synonym Full Names
lysine demethylase 5B
NCBI Official Symbol
KDM5B
NCBI Official Synonym Symbols
CT31; PLU1; PUT1; MRT65; PLU-1; JARID1B; PPP1R98; RBP2-H1; RBBP2H1A
NCBI Protein Information
lysine-specific demethylase 5B
UniProt Protein Name
Lysine-specific demethylase 5B
UniProt Gene Name
KDM5B
UniProt Synonym Gene Names
JARID1B; PLU1; RBBP2H1; CT31; RBP2-H1

NCBI Description

This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]

Uniprot Description

JARID1B: Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma. Interacts with FOXG1B, PAX9, MYC, MYCN and RB1. Interacts with HDAC1, HDAC4, HDAC5 and HDAC7. Ubiquitously expressed, with highest levels in testis. Down-regulated in melanoma and glioblastoma. Up-regulated in breast cancer. Belongs to the JARID1 histone demethylase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA); Demethylase; EC 1.14.11.-; Oxidoreductase; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: cytoplasm; nucleoplasm; nucleus

Molecular Function: histone demethylase activity; histone demethylase activity (H3-K4 specific); protein binding; transcription corepressor activity; transcription factor activity

Research Articles on KDM5B

Similar Products

Product Notes

The KDM5B kdm5b (Catalog #AAA3219244) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KDM5B Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KDM5B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KDM5B kdm5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EMKKFPDNDL LRHLRLVTQD AEKCASVAQQ LLNGKRQTRY RSGGGKSQNQ. It is sometimes possible for the material contained within the vial of "KDM5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.