Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KCNQ5Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human KCNQ5 Polyclonal Antibody | anti-KCNQ5 antibody

KCNQ5 Antibody - C-terminal region

Gene Names
KCNQ5; Kv7.5; MRD46
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KCNQ5; Polyclonal Antibody; KCNQ5 Antibody - C-terminal region; anti-KCNQ5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAP
Sequence Length
942
Applicable Applications for anti-KCNQ5 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KCNQ5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KCNQ5Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KCNQ5Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KCNQ5 antibody
potassium voltage-gated channel, KQT-like subfamily, member 5

Target Description: This gene is a member of the KCNQ potassium channel gene family that is differentially expressed in subregions of the brain and in skeletal muscle. The protein encoded by this gene yields currents that activate slowly with depolarization and can form heteromeric channels with the protein encoded by the KCNQ3 gene. Currents expressed from this protein have voltage dependences and inhibitor sensitivities in common with M-currents. They are also inhibited by M1 muscarinic receptor activation. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-KCNQ5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103 kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily KQT member 5 isoform 1
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily Q member 5
NCBI Official Symbol
KCNQ5
NCBI Official Synonym Symbols
Kv7.5; MRD46
NCBI Protein Information
potassium voltage-gated channel subfamily KQT member 5
UniProt Protein Name
Potassium voltage-gated channel subfamily KQT member 5
UniProt Gene Name
KCNQ5
UniProt Entry Name
KCNQ5_HUMAN

NCBI Description

This gene is a member of the KCNQ potassium channel gene family that is differentially expressed in subregions of the brain and in skeletal muscle. The protein encoded by this gene yields currents that activate slowly with depolarization and can form heteromeric channels with the protein encoded by the KCNQ3 gene. Currents expressed from this protein have voltage dependences and inhibitor sensitivities in common with M-currents. They are also inhibited by M1 muscarinic receptor activation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]

Uniprot Description

Kv7.5: Probably important in the regulation of neuronal excitability. Associates with KCNQ3 to form a potassium channel which contributes to M-type current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons. May contribute, with other potassium channels, to the molecular diversity of a heterogeneous population of M-channels, varying in kinetic and pharmacological properties, which underlie this physiologically important current. Insensitive to tetraethylammonium, but inhibited by barium, linopirdine and XE991. Activated by niflumic acid and the anticonvulsant retigabine. Muscarine suppresses KCNQ5 current in Xenopus oocytes in which cloned KCNQ5 channels were coexpressed with M(1) muscarinic receptors. Belongs to the potassium channel family. KQT (TC 1.A.1.15) subfamily. Kv7.5/KCNQ5 sub-subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Channel, potassium

Chromosomal Location of Human Ortholog: 6q14

Cellular Component: voltage-gated potassium channel complex; integral to membrane; plasma membrane

Molecular Function: delayed rectifier potassium channel activity; inward rectifier potassium channel activity

Biological Process: synaptic transmission; protein complex assembly

Research Articles on KCNQ5

Similar Products

Product Notes

The KCNQ5 kcnq5 (Catalog #AAA3202516) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNQ5 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNQ5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNQ5 kcnq5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELNIQLSGSE SSGSRGSQDF YPKWRESKLF ITDEEVGPEE TETDTFDAAP. It is sometimes possible for the material contained within the vial of "KCNQ5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.