Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (KCNMA1 antibody - C-terminal Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasm in Human Pineal TissuePrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Rabbit KCNMA1 Polyclonal Antibody | anti-KCNMA1 antibody

KCNMA1 antibody - C-terminal

Gene Names
KCNMA1; SLO; BKTM; SLO1; hSlo; MaxiK; PNKD3; SAKCA; mSLO1; CADEDS; KCa1.1; SLO-ALPHA; bA205K10.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KCNMA1; Polyclonal Antibody; KCNMA1 antibody - C-terminal; anti-KCNMA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG
Sequence Length
1182
Applicable Applications for anti-KCNMA1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the c terminal region of human KCNMA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(KCNMA1 antibody - C-terminal Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasm in Human Pineal TissuePrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (KCNMA1 antibody - C-terminal Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasm in Human Pineal TissuePrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Prostate)

Immunohistochemistry (IHC) (Prostate)

Western Blot (WB)

(Host: RabbitTarget Name: KCNMA1Sample Type: HepG2Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KCNMA1Sample Type: HepG2Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: KCNMA1Sample Type: JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KCNMA1Sample Type: JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-KCNMA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-KCNMA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-KCNMA1 antibody
This is a rabbit polyclonal antibody against KCNMA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-KCNMA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
131kDa
NCBI Official Full Name
calcium-activated potassium channel subunit alpha-1 isoform a
NCBI Official Synonym Full Names
potassium calcium-activated channel subfamily M alpha 1
NCBI Official Symbol
KCNMA1
NCBI Official Synonym Symbols
SLO; BKTM; SLO1; hSlo; MaxiK; PNKD3; SAKCA; mSLO1; CADEDS; KCa1.1; SLO-ALPHA; bA205K10.1
NCBI Protein Information
calcium-activated potassium channel subunit alpha-1; uncharacterized protein
UniProt Protein Name
Calcium-activated potassium channel subunit alpha-1
UniProt Gene Name
KCNMA1
UniProt Synonym Gene Names
KCNMA; SLO; MaxiK; Slo homolog; hSlo
UniProt Entry Name
KCMA1_HUMAN

NCBI Description

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNMA1: Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca(2+), caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX). Defects in KCNMA1 are the cause of generalized epilepsy and paroxysmal dyskinesia (GEPD). Epilepsy is one of the most common and debilitating neurological disorders. Paroxysmal dyskinesias are neurological disorders characterized by sudden, unpredictable, disabling attacks of involuntary movement often requiring life-long treatment. The coexistence of epilepsy and paroxysmal dyskinesia in the same individual or family is an increasingly recognized phenomenon. Patients manifest absence seizures, generalized tonic-clonic seizures, paroxysmal nonkinesigenic dyskinesia, involuntary dystonic or choreiform movements. Onset is usually in childhood and patients may have seizures only, dyskinesia only, or both. Belongs to the potassium channel family. Calcium- activated (TC 1.A.1.3) subfamily. KCa1.1/KCNMA1 sub-subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Endoplasmic reticulum; Membrane protein, integral; Channel, potassium

Chromosomal Location of Human Ortholog: 10q22.3

Cellular Component: voltage-gated potassium channel complex; apical plasma membrane; integral to membrane; plasma membrane; caveola

Molecular Function: voltage-gated potassium channel activity; protein binding; calcium-activated potassium channel activity; metal ion binding; large conductance calcium-activated potassium channel activity; actin binding

Biological Process: synaptic transmission; regulation of membrane potential; positive regulation of apoptosis; smooth muscle contraction involved in micturition; response to hypoxia; blood coagulation; response to calcium ion; response to osmotic stress; cellular potassium ion homeostasis; negative regulation of cell volume; micturition; potassium ion transport

Disease: Generalized Epilepsy And Paroxysmal Dyskinesia

Research Articles on KCNMA1

Similar Products

Product Notes

The KCNMA1 kcnma1 (Catalog #AAA3202425) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNMA1 antibody - C-terminal reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KCNMA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the KCNMA1 kcnma1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CFGIYRLRDA HLSTPSQCTK RYVITNPPYE FELVPTDLIF CLMQFDHNAG. It is sometimes possible for the material contained within the vial of "KCNMA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.