Western Blot (WB)
(WB Suggested Anti-KCNK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Rabbit KCNK1 Polyclonal Antibody | anti-KCNK1 antibody
KCNK1 antibody - middle region
Gene Names
KCNK1; DPK; HOHO; K2P1; KCNO1; TWIK1; K2p1.1; TWIK-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNK1; Polyclonal Antibody; KCNK1 antibody - middle region; anti-KCNK1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Sequence Length
336
Applicable Applications for anti-KCNK1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-KCNK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Western Blot (WB)
(WB Suggested Anti-KCNK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Related Product Information for anti-KCNK1 antibody
This is a rabbit polyclonal antibody against KCNK1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-KCNK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
potassium channel subfamily K member 1
NCBI Official Synonym Full Names
potassium two pore domain channel subfamily K member 1
NCBI Official Symbol
KCNK1
NCBI Official Synonym Symbols
DPK; HOHO; K2P1; KCNO1; TWIK1; K2p1.1; TWIK-1
NCBI Protein Information
potassium channel subfamily K member 1
UniProt Protein Name
Potassium channel subfamily K member 1
Protein Family
UniProt Gene Name
KCNK1
UniProt Synonym Gene Names
HOHO1; KCNO1; TWIK1
UniProt Entry Name
KCNK1_HUMAN
NCBI Description
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq, Jul 2008]
Uniprot Description
KCNK1: Weakly inward rectifying potassium channel. Homodimer (Potential). Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 1q42-q43
Cellular Component: voltage-gated potassium channel complex; brush border membrane; apical plasma membrane; plasma membrane; endosome
Molecular Function: inward rectifier potassium channel activity
Biological Process: response to nicotine; synaptic transmission; potassium ion transport
Research Articles on KCNK1
Similar Products
Product Notes
The KCNK1 kcnk1 (Catalog #AAA3202423) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNK1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNK1 kcnk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDQVHIIEHD QLSFSSITDQ AAGMKEDQKQ NEPFVATQSS ACVDGPANH. It is sometimes possible for the material contained within the vial of "KCNK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
