Western Blot (WB)
(Host: RabbitTarget Name: KCNJ1Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse KCNJ1 Polyclonal Antibody | anti-KCNJ1 antibody
KCNJ1 Antibody-middle region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNJ1; Polyclonal Antibody; KCNJ1 Antibody-middle region; ATP-sensitive inward rectifier potassium channel 1; ROMK; Romk2; Kir1.1; anti-KCNJ1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
SRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLK
Applicable Applications for anti-KCNJ1 antibody
Western Blot (WB)
Protein Size
372 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse KCNJ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: KCNJ1Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: KCNJ1Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KCNJ1 antibody
Description of Target: In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium (By similarity).
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
43kDa
UniProt Protein Name
ATP-sensitive inward rectifier potassium channel 1
Protein Family
UniProt Gene Name
Kcnj1
UniProt Entry Name
KCNJ1_MOUSE
Similar Products
Product Notes
The KCNJ1 kcnj1 (Catalog #AAA3249803) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNJ1 Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KCNJ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNJ1 kcnj1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SRPKKRAKTI TFSKNAVISK RGGKLCLLIR VANLRKSLLI GSHIYGKLLK. It is sometimes possible for the material contained within the vial of "KCNJ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
