Rabbit KCNG4 Polyclonal Antibody | anti-KCNG4 antibody

KCNG4 Polyclonal Antibody

Cat. Num. AAA9134438

• Gene Names: KCNG4; KV6.3; KV6.4
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: KCNG4; Polyclonal Antibody; KCNG4 Polyclonal Antibody; KV6.3; KV6.4; anti-KCNG4 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: MPMPSRDGGLHPRHHHYGSHSPWSQLLSSPMETPSIKGLYYRRVRKVGALDASPVDLKKEILINVGGRRYLLPWSTLDRFPLSRLSKLRLCRSYEEIVQLCDDYDEDSQEFFFDRSPSAFGVIVSFLAAGKLVLLQEMCALSFQEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRPASHSSRWGLCMNRLREMVENPQSGLPG
• Sequence Length: 519

• Applicable Applications for anti-KCNG4 antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: Recombinant protein of human KCNG4
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Cell membrane, Multi-pass membrane protein
• Positive Samples: U-87MG, DU145, 293T, Mouse testis, Mouse eye, Mouse brain, Rat testis
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using KCNG4 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.)

Related Product Information for anti-KCNG4 antibody

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The gene has strong expression in brain. Multiple alternatively spliced variants have been found in normal and cancerous tissues.

Product Categories/Family for anti-KCNG4 antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 27436996
• NCBI GeneID: 93107
• NCBI Accession #: NP_758857.1
• NCBI GenBank Nucleotide #: NM_172347.2
• UniProt Accession #: Q8TDN1; Q96H24
• Molecular Weight: Calculated: 29kDa; 58kDa; Observed: 57kDa
• NCBI Official Full Name: potassium voltage-gated channel subfamily G member 4
• NCBI Official Synonym Full Names: potassium voltage-gated channel modifier subfamily G member 4
• NCBI Official Symbol: KCNG4
• NCBI Official Synonym Symbols: KV6.3; KV6.4
• NCBI Protein Information: potassium voltage-gated channel subfamily G member 4
• UniProt Protein Name: Potassium voltage-gated channel subfamily G member 4
• Protein Family: Potassium voltage-gated channel subfamily
• UniProt Gene Name: KCNG4
• UniProt Synonym Gene Names: KCNG3

NCBI Description

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The gene has strong expression in brain. Multiple alternatively spliced variants have been found in normal and cancerous tissues. [provided by RefSeq, Jul 2008]

Uniprot Description

Potassium channel subunit that does not form functional channels by itself. Can form functional heterotetrameric channels with KCNB1; modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 (PubMed:19074135).