Testing Data
Rabbit anti-Human, Rat KCNE1 Polyclonal Antibody | anti-KCNE1 antibody
Anti-KCNE1 (IsK) Antibody
Gene Names
KCNE1; ISK; JLNS; LQT5; MinK; JLNS2; LQT2/5
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified on immobilized IsK-His.
Synonyms
KCNE1; Polyclonal Antibody; Anti-KCNE1 (IsK) Antibody; anti-KCNE1 antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Specificity
Cat, mouse, rat, rabbit, pig, guinea pig-respectively, 50/61, 49/61, 49/61, 47/62, 48/6/, and 46/58 residues identical.
Purity/Purification
Affinity Purified on immobilized IsK-His.
Form/Format
Liquid; PBS, pH 7.4 with 0.05% sodium azide.
Concentration
1ug/ul (varies by lot)
Sequence Length
129
Applicable Applications for anti-KCNE1 antibody
Western Blot (WB)
Application Notes
WB: Rat heart membranes (1:100-1:200)
Immunogen
GST fusion protein with a sequence RSKKLEHSNDPFNVY IESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETK PSP, corresponding to residues 67-129 of human KCNE1 (IsK) (Accession P15382).
Preparation and Storage
This product is stable for several weeks at 4 degree C as an undiluted liquid. Dilute only prior to immediate use.
For extended storage, aliquot contents and freeze at-20 degree C or below. Avoid cycles of freezing and thawing. Expiration date is one (1) year from date of receipt.
For extended storage, aliquot contents and freeze at-20 degree C or below. Avoid cycles of freezing and thawing. Expiration date is one (1) year from date of receipt.
Testing Data
Testing Data
Testing Data
Testing Data
Related Product Information for anti-KCNE1 antibody
In 1999, three gene families that encode minK-related peptides (MiRPs) were identified (known also as IsK-related auxiliary subunits). These MiRPs, along with minK, constitute four KCNE families (KCNE1 to KCNE4, encoding minK and MiRP1 to MiRP3).1 MiRP1 mutations that are linked to congenital (LQT6) or acquired LQT syndrome have been identified. However, currently there is no biochemical evidence supporting an association between native MiRP1 and hERG proteins in cardiac myocytes.2 MiRP2 has been shown to decrease the single channel conductance and accelerates the rate of HERG channel deactivation3 and to suppress the expression of hERG in oocytes.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
KCNE1, partial
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily E regulatory subunit 1
NCBI Official Symbol
KCNE1
NCBI Official Synonym Symbols
ISK; JLNS; LQT5; MinK; JLNS2; LQT2/5
NCBI Protein Information
potassium voltage-gated channel subfamily E member 1
Protein Family
NCBI Description
The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
Research Articles on KCNE1
Similar Products
Product Notes
The KCNE1 (Catalog #AAA4159249) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-KCNE1 (IsK) Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: Rat heart membranes (1:100-1:200). Researchers should empirically determine the suitability of the KCNE1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
