Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KCNA2 antibody Titration: 1 ug/mLSample Type: Human MCF7 Whole Cell)

Rabbit anti-Human KCNA2 Polyclonal Antibody | anti-KCNA2 antibody

KCNA2 Antibody - N-terminal region

Gene Names
KCNA2; HK4; MK2; HBK5; NGK1; RBK2; HUKIV; KV1.2; EIEE32
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KCNA2; Polyclonal Antibody; KCNA2 Antibody - N-terminal region; anti-KCNA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGD
Sequence Length
499
Applicable Applications for anti-KCNA2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KCNA2 antibody Titration: 1 ug/mLSample Type: Human MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-KCNA2 antibody Titration: 1 ug/mLSample Type: Human MCF7 Whole Cell)
Related Product Information for anti-KCNA2 antibody
This is a rabbit polyclonal antibody against KCNA2. It was validated on Western Blot

Target Description: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.
Product Categories/Family for anti-KCNA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily A member 2 isoform a
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily A member 2
NCBI Official Symbol
KCNA2
NCBI Official Synonym Symbols
HK4; MK2; HBK5; NGK1; RBK2; HUKIV; KV1.2; EIEE32
NCBI Protein Information
potassium voltage-gated channel subfamily A member 2
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 2
UniProt Gene Name
KCNA2
UniProt Entry Name
KCNA2_HUMAN

NCBI Description

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1. [provided by RefSeq, Jul 2008]

Uniprot Description

Kv1.2: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.2/KCNA2 sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Channel, potassium; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p13

Cellular Component: axon; cell junction; dendrite; endoplasmic reticulum membrane; integral to plasma membrane; lamellipodium; nerve terminal; perikaryon; plasma membrane; presynaptic membrane; voltage-gated potassium channel complex

Molecular Function: delayed rectifier potassium channel activity; potassium channel activity; protein binding; voltage-gated potassium channel activity

Biological Process: generation of action potential; optic nerve structural organization; potassium ion transport; protein homooligomerization; regulation of circadian sleep/wake cycle, non-REM sleep; regulation of dopamine secretion; sensory perception of pain

Disease: Epileptic Encephalopathy, Early Infantile, 32

Research Articles on KCNA2

Similar Products

Product Notes

The KCNA2 kcna2 (Catalog #AAA3220308) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNA2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNA2 kcna2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAALPGHPQD TYDPEADHEC CERVVINISG LRFETQLKTL AQFPETLLGD. It is sometimes possible for the material contained within the vial of "KCNA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.