Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CSR2B antibody Titration: 1 ug/mLSample Type: Human HepG2 Whole Cell)

Rabbit anti-Human KAT14 Polyclonal Antibody | anti-KAT14 antibody

KAT14 Antibody - N-terminal region

Gene Names
KAT14; ATAC2; CRP2BP; CSRP2BP; PRO1194; dJ717M23.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KAT14; Polyclonal Antibody; KAT14 Antibody - N-terminal region; anti-KAT14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESEDQASVDLSHDQSGDSLNSDEGDVSWMEEQLSYFCDKCQKWIPASQLR
Sequence Length
782
Applicable Applications for anti-KAT14 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-CSRP2BP antibody is: synthetic peptide directed towards the N-terminal region of Human CSR2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CSR2B antibody Titration: 1 ug/mLSample Type: Human HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CSR2B antibody Titration: 1 ug/mLSample Type: Human HepG2 Whole Cell)
Related Product Information for anti-KAT14 antibody
This is a rabbit polyclonal antibody against CSR2B. It was validated on Western Blot

Target Description: CSRP2 is a protein containing two LIM domains, which are double zinc finger motifs found in proteins of diverse function. CSRP2 and some related proteins are thought to act as protein adapters, bridging two or more proteins to form a larger protein complex. The protein encoded by this gene binds to one of the LIM domains of CSRP2 and contains an acetyltransferase domain. Although the encoded protein has been detected in the cytoplasm, it is predominantly a nuclear protein. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-KAT14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86 kDa
NCBI Official Full Name
cysteine-rich protein 2-binding protein
NCBI Official Synonym Full Names
lysine acetyltransferase 14
NCBI Official Symbol
KAT14
NCBI Official Synonym Symbols
ATAC2; CRP2BP; CSRP2BP; PRO1194; dJ717M23.1
NCBI Protein Information
cysteine-rich protein 2-binding protein
UniProt Protein Name
Cysteine-rich protein 2-binding protein
UniProt Gene Name
CSRP2BP
UniProt Synonym Gene Names
CSRP2-binding protein; ATAC2; CRP2BP
UniProt Entry Name
CSR2B_HUMAN

NCBI Description

CSRP2 is a protein containing two LIM domains, which are double zinc finger motifs found in proteins of diverse function. CSRP2 and some related proteins are thought to act as protein adapters, bridging two or more proteins to form a larger protein complex. The protein encoded by this gene binds to one of the LIM domains of CSRP2 and contains an acetyltransferase domain. Although the encoded protein has been detected in the cytoplasm, it is predominantly a nuclear protein. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jun 2011]

Uniprot Description

CSRP2BP: Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. May function as a scaffold for the ATAC complex to promote ATAC complex stability. Has also weak histone acetyltransferase activity toward histone H4. Required for the normal progression through G1 and G2/M phases of the cell cycle. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 20p11.23

Cellular Component: cytoplasm; nucleus

Molecular Function: histone acetyltransferase activity; LIM domain binding; protein binding

Biological Process: establishment and/or maintenance of chromatin architecture; G2/M transition of mitotic cell cycle

Research Articles on KAT14

Similar Products

Product Notes

The KAT14 csrp2bp (Catalog #AAA3219326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KAT14 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KAT14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KAT14 csrp2bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESEDQASVDL SHDQSGDSLN SDEGDVSWME EQLSYFCDKC QKWIPASQLR. It is sometimes possible for the material contained within the vial of "KAT14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.