Rabbit KARS Polyclonal Antibody | anti-KARS antibody

KARS antibody - C-terminal region

Cat. Num. AAA3205343

• Gene Names: KARS; KRS; KARS1; KARS2; CMTRIB; DFNB89
• Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: KARS; Polyclonal Antibody; KARS antibody - C-terminal region; anti-KARS antibody

• Host: Rabbit
• Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
• Sequence Length: 597

• Applicable Applications for anti-KARS antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 92%; Guinea Pig: 85%; Horse: 88%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 86%; Rat: 86%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KARS
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(KARS antibody - C-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm of bronchial epithelial tissuePrimary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Rabbit Anti-KARS AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-KARS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateKARS is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Related Product Information for anti-KARS antibody

This is a rabbit polyclonal antibody against KARS. It was validated on Western Blot and immunohistochemistry

Target Description: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis.

Product Categories/Family for anti-KARS antibody

Polyclonal; RNA Binding Proteins; Disease Related; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 5031815
• NCBI GeneID: 3735
• NCBI Accession #: NP_005539
• NCBI GenBank Nucleotide #: NM_005548
• UniProt Accession #: Q15046
• Molecular Weight: 66kDa
• NCBI Official Full Name: lysine--tRNA ligase isoform 2
• NCBI Official Synonym Full Names: lysyl-tRNA synthetase
• NCBI Official Symbol: KARS
• NCBI Official Synonym Symbols: KRS; KARS1; KARS2; CMTRIB; DFNB89
• NCBI Protein Information: lysine--tRNA ligase
• UniProt Protein Name: Lysine--tRNA ligase
• UniProt Gene Name: KARS
• UniProt Synonym Gene Names: KIAA0070; LysRS
• UniProt Entry Name: SYK_HUMAN

NCBI Description

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

KARS: Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA. When secreted, acts as a signaling molecule that induces immune response through the activation of monocyte/macrophages. Catalyzes the synthesis of diadenosine oligophosphate (Ap4A), a signaling molecule involved in the activation of MITF transcriptional activity. Interacts with HIV-1 virus GAG protein, facilitating the selective packaging of tRNA(3)(Lys), the primer for reverse transcription initiation. Homodimer; also part of a multisubunit complex that groups AIMP1, AIMP2, EEF1A1 and tRNA ligases for Arg, Asp, Glu, Gln, Ile, Leu, Lys, Met and Pro. Interacts with AIMP2 (via N- terminus) and MITF. Interacts directly with HIV-1 virus GAG protein. Up-regulated by DARS and EEF1A1, but not by AIMP2. Belongs to the class-II aminoacyl-tRNA synthetase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.1.1.6; Translation; Ligase; Mitochondrial

Chromosomal Location of Human Ortholog: 16q23.1

Cellular Component: microtubule cytoskeleton; aminoacyl-tRNA synthetase multienzyme complex; mitochondrion; mitochondrial matrix; cytoplasm; extracellular region; plasma membrane; nucleus; cytosol

Molecular Function: amino acid binding; protein binding; metal ion binding; lysine-tRNA ligase activity; ATP binding; tRNA binding

Biological Process: tRNA aminoacylation for protein translation; lysyl-tRNA aminoacylation; viral reproduction; tRNA processing; gene expression; diadenosine tetraphosphate biosynthetic process

Disease: Deafness, Autosomal Recessive 89; Charcot-marie-tooth Disease, Recessive Intermediate B