Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-JMY AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit JMY Polyclonal Antibody | anti-JMY antibody

JMY antibody - N-terminal region

Gene Names
JMY; WHAMM2; WHDC1L3
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
JMY; Polyclonal Antibody; JMY antibody - N-terminal region; anti-JMY antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFIVAWNEIEGKFAITCHNRTAQRQRSGSREQAGARGGAEAGGAASDGSR
Sequence Length
712
Applicable Applications for anti-JMY antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-JMY AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-JMY AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-JMY antibody
This is a rabbit polyclonal antibody against JMY. It was validated on Western Blot

Target Description: JMY acts both as a nuclear p53/TP53-cofactor and a cytoplasmic regulator of actin dynamics depending on conditions. In nucleus, JMY acts as a cofactor that increases p53/TP53 response via its interaction with p300/EP300. JMY increases p53/TP53-dependent transcription and apoptosis, suggesting an important role in p53/TP53 stress response such as DNA damage. In cytoplasm, JMY acts as a nucleation-promoting factor for both branched and unbranched actin filaments. JMY activates the Arp2/3 complex to induce branched actin filament networks. JMY also catalyzes actin polymerization in the absence of Arp2/3, creating unbranched filaments. JMY contributes to cell motility by controlling actin dynamics. JMY may promote the rapid formation of a branched actin network by first nucleating new mother filaments and then activating Arp2/3 to branch off these filaments. The p53/TP53-cofactor and actin activator activities are regulated via its subcellular location.
Product Categories/Family for anti-JMY antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
junction-mediating and -regulatory protein
NCBI Official Synonym Full Names
junction mediating and regulatory protein, p53 cofactor
NCBI Official Symbol
JMY
NCBI Official Synonym Symbols
WHAMM2; WHDC1L3
NCBI Protein Information
junction-mediating and -regulatory protein
UniProt Protein Name
Junction-mediating and -regulatory protein
UniProt Gene Name
JMY
UniProt Entry Name
JMY_HUMAN

Uniprot Description

JMY: Acts both as a nuclear p53/TP53-cofactor and a cytoplasmic regulator of actin dynamics depending on conditions. In nucleus, acts as a cofactor that increases p53/TP53 response via its interaction with p300/EP300. Increases p53/TP53-dependent transcription and apoptosis, suggesting an important role in p53/TP53 stress response such as DNA damage. In cytoplasm, acts as a nucleation-promoting factor for both branched and unbranched actin filaments. Activates the Arp2/3 complex to induce branched actin filament networks. Also catalyzes actin polymerization in the absence of Arp2/3, creating unbranched filaments. Contributes to cell motility by controlling actin dynamics. May promote the rapid formation of a branched actin network by first nucleating new mother filaments and then activating Arp2/3 to branch off these filaments. The p53/TP53-cofactor and actin activator activities are regulated via its subcellular location. Belongs to the JMY family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 5q14.1

Cellular Component: nucleoplasm; cytoskeleton; leading edge; cytoplasm; plasma membrane; cell junction; nucleus

Molecular Function: protein binding; transcription coactivator activity; actin binding

Biological Process: regulation of transcription from RNA polymerase II promoter; positive regulation of apoptosis; positive regulation of transcription factor activity; cell cycle arrest; DNA repair

Research Articles on JMY

Similar Products

Product Notes

The JMY jmy (Catalog #AAA3216554) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JMY antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's JMY can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the JMY jmy for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFIVAWNEIE GKFAITCHNR TAQRQRSGSR EQAGARGGAE AGGAASDGSR. It is sometimes possible for the material contained within the vial of "JMY, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.