Western Blot (WB)
(WB Suggested Anti-JMJD2B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Rabbit JMJD2B Polyclonal Antibody | anti-KDM4B antibody
JMJD2B antibody - middle region
Gene Names
KDM4B; JMJD2B; TDRD14B
Reactivity
Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
JMJD2B; Polyclonal Antibody; JMJD2B antibody - middle region; anti-KDM4B antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF
Sequence Length
1096
Applicable Applications for anti-KDM4B antibody
Western Blot (WB)
Homology
Dog: 92%; Horse: 92%; Human: 100%; Pig: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human JMJD2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-JMJD2B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-JMJD2B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-KDM4B antibody
This is a rabbit polyclonal antibody against JMJD2B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes. Human genes corresponding to KIAA0677, KIAA0876, KIAA0780 and FLJ10251 cDNAs were designated JMJD2A, JMJD2B, JMJD2C, and JMJD2D, respectively. In addition, JMJD2D homologous genes within human genome sequences AP002383.3 and AP001264.4 were designated JMJD2E and JMJD2F, respectively. C2HC2HC2- and C5HC2-type Cys (His) clusters were identified as the region conserved among JMJD2A (1064 aa), JMJD2B (1096 aa), and JMJD2C (1056 aa) proteins. JMJD2A, JMJD2B and JMJD2C consist of JmjN, JmjC, JD2H, and two TUDOR domains.
Target Description: JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes. Human genes corresponding to KIAA0677, KIAA0876, KIAA0780 and FLJ10251 cDNAs were designated JMJD2A, JMJD2B, JMJD2C, and JMJD2D, respectively. In addition, JMJD2D homologous genes within human genome sequences AP002383.3 and AP001264.4 were designated JMJD2E and JMJD2F, respectively. C2HC2HC2- and C5HC2-type Cys (His) clusters were identified as the region conserved among JMJD2A (1064 aa), JMJD2B (1096 aa), and JMJD2C (1056 aa) proteins. JMJD2A, JMJD2B and JMJD2C consist of JmjN, JmjC, JD2H, and two TUDOR domains.
Product Categories/Family for anti-KDM4B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
122kDa
NCBI Official Full Name
lysine-specific demethylase 4B
NCBI Official Synonym Full Names
lysine demethylase 4B
NCBI Official Symbol
KDM4B
NCBI Official Synonym Symbols
JMJD2B; TDRD14B
NCBI Protein Information
lysine-specific demethylase 4B
UniProt Protein Name
Lysine-specific demethylase 4B
Protein Family
UniProt Gene Name
KDM4B
UniProt Synonym Gene Names
JHDM3B; JMJD2B; KIAA0876
UniProt Entry Name
KDM4B_HUMAN
Uniprot Description
JMJD2B: Histone demethylase that specifically demethylates 'Lys- 9' of histone H3, thereby playing a role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27', H3 'Lys-36' nor H4 'Lys-20'. Only able to demethylate trimethylated H3 'Lys-9', with a weaker activity than KDM4A, KDM4C and KDM4D. Demethylation of Lys residue generates formaldehyde and succinate. Belongs to the JHDM3 histone demethylase family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Demethylase; EC 1.14.11.-; Oxidoreductase
Chromosomal Location of Human Ortholog: 19p13.3
Cellular Component: nucleoplasm; focal adhesion; nucleus; cell junction
Molecular Function: dioxygenase activity; zinc ion binding
Biological Process: establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent; transcription, DNA-dependent; chromatin modification
Research Articles on KDM4B
Similar Products
Product Notes
The KDM4B kdm4b (Catalog #AAA3213870) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JMJD2B antibody - middle region reacts with Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's JMJD2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KDM4B kdm4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CAICTLFYPY CQALQTEKEA PIASLGEGCP ATLPSKSRQK TRPLIPEMCF. It is sometimes possible for the material contained within the vial of "JMJD2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
