Rabbit JAK1 Polyclonal Antibody | anti-JAK1 antibody

Anti-JAK1 Antibody

Cat. Num. AAA178603

• Gene Names: JAK1; JTK3; JAK1A; JAK1B
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Immunogen affinity purified.
• Synonyms: JAK1; Polyclonal Antibody; Anti-JAK1 Antibody; JAK 1A; JAK-1; JAK1A; JAK1B; Tyrosineprotein kinase JAK1; Tyrosine-protein kinase JAK1; P23458; Janus kinase 1; anti-JAK1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 1154

• Applicable Applications for anti-JAK1 antibody: Western Blot (WB)
• Application Notes: Western Blot: 0.1-0.5ug/ml
• Notes: Tested Species: In-house tested species with positive results.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78-115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN), different from the related mouse sequence by three amino acids.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of JAK1 expression in rat kidney extract (lane 1), mouse kidney extract (lane 2) and HELA whole cell lysates (lane 3). JAK1 at 133KD was detected using rabbit anti- JAK1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Related Product Information for anti-JAK1 antibody

Rabbit IgG polyclonal antibody for Tyrosine-protein kinase JAK1(JAK1) detection.
Background: JAK1 (JANUS KINASE 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-alpha/beta) and type II (IFN-gamma) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.

References

1. Gadina M, Hilton D, Johnston JA, Morinobu A, Lighvani A, Zhou YJ, Visconti R, O'Shea JJ (2001). "Signaling by type I and II cytokine receptors: ten years after".
2. Gough, N. M., Rakar, S., Harpur, A., Wilks, A. F. Localization of genes for two members of the JAK family of protein tyrosine kinases to murine chromosomes 4 and 19. Mammalian Genome 6: 247-248, 1995.
3. Howard, O. M. Z., Dean, M., Young, H., Ramsburg, M., Turpin, J. A., Michiel, D. F., Kelvin, D. J., Lee, L., Farrar, W. L. Characterization of a class 3 tyrosine kinase. Oncogene 7: 895-900, 1992.

NCBI and Uniprot Product Information

• NCBI GI #: 1004007314
• NCBI GeneID: 3716
• NCBI Accession #: NP_001307852.1
• NCBI GenBank Nucleotide #: NM_001320923.1
• UniProt Accession #: P23458; Q59GQ2; Q9UD26
• Molecular Weight: 133,277 Da
• NCBI Official Full Name: tyrosine-protein kinase JAK1 isoform 1
• NCBI Official Synonym Full Names: Janus kinase 1
• NCBI Official Symbol: JAK1
• NCBI Official Synonym Symbols: JTK3; JAK1A; JAK1B
• NCBI Protein Information: tyrosine-protein kinase JAK1
• UniProt Protein Name: Tyrosine-protein kinase JAK1
• Protein Family: Tyrosine-protein kinase
• UniProt Gene Name: JAK1
• UniProt Synonym Gene Names: JAK1A; JAK1B; JAK-1

NCBI Description

This gene encodes a membrane protein that is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. The encoded kinase phosphorylates STAT proteins (signal transducers and activators of transcription) and plays a key role in interferon-alpha/beta and interferon-gamma signal transduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

JAK1: a widely expressed non-receptor tyrosine-kinase involved in the interferon-alpha/beta and -gamma signal transduction pathways. Couples cytokine ligand binding to tyrosine phosphorylation of various known signaling proteins and of a unique family of transcription factors termed the signal transducers and activators of transcription, or STATs. A selective Jak1 inhibitor induces apoptosis in NRP-154 prostate cancer cell line. A single mutation seen in tyrosine kinome screen of colon cancers. Activated in B cell lines from patients with post-transplant lymphoproliferative disorder, and in a mouse Lck-driven T cell lymphoma. Inhibitor: Piceatannol.

Protein type: EC 2.7.10.2; JakA family; Kinase, protein; Protein kinase, TK; Protein kinase, tyrosine (non-receptor); TK group

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: cytoplasm; cytosol; extrinsic to internal side of plasma membrane; focal adhesion; nucleus

Molecular Function: growth hormone receptor binding; non-membrane spanning protein tyrosine kinase activity; protein binding; protein phosphatase binding; protein-tyrosine kinase activity; Ras guanyl-nucleotide exchange factor activity; receptor binding; ubiquitin protein ligase binding

Biological Process: cell differentiation; cell migration; innate immune response; MAPKKK cascade; protein amino acid phosphorylation; regulation of cell proliferation; response to antibiotic; transmembrane receptor protein tyrosine kinase signaling pathway