Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ITPR2Sample Type: Fetal Small Intestine lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ITPR2 Polyclonal Antibody | anti-ITPR2 antibody

ITPR2 Antibody - N-terminal region

Gene Names
ITPR2; ANHD; IP3R2; CFAP48; INSP3R2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ITPR2; Polyclonal Antibody; ITPR2 Antibody - N-terminal region; anti-ITPR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRDCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQ
Sequence Length
181
Applicable Applications for anti-ITPR2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN ITPR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ITPR2Sample Type: Fetal Small Intestine lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ITPR2Sample Type: Fetal Small Intestine lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ITPR2 antibody
This is a rabbit polyclonal antibody against ITPR2. It was validated on Western Blot

Target Description: ITPR2 is a receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium. This release is regulated by cAMP both dependently and independently of PKA.
Product Categories/Family for anti-ITPR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
inositol 1,4,5-trisphosphate receptor type 2
NCBI Official Synonym Full Names
inositol 1,4,5-trisphosphate receptor type 2
NCBI Official Symbol
ITPR2
NCBI Official Synonym Symbols
ANHD; IP3R2; CFAP48; INSP3R2
NCBI Protein Information
inositol 1,4,5-trisphosphate receptor type 2
UniProt Protein Name
Inositol 1,4,5-trisphosphate receptor type 2
UniProt Gene Name
ITPR2
UniProt Synonym Gene Names
IP3R 2; InsP3R2; Type 2 InsP3 receptor
UniProt Entry Name
ITPR2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the inositol 1,4,5-triphosphate receptor family, whose members are second messenger intracellular calcium release channels. These proteins mediate a rise in cytoplasmic calcium in response to receptor activated production of inositol triphosphate. Inositol triphosphate receptor-mediated signaling is involved in many processes including cell migration, cell division, smooth muscle contraction, and neuronal signaling. This protein is a type 2 receptor that consists of a cytoplasmic amino-terminus that binds inositol triphosphate, six membrane-spanning helices that contribute to the ion pore, and a short cytoplasmic carboxy-terminus. A mutation in this gene has been associated with anhidrosis, suggesting that intracellular calcium release mediated by this protein is required for eccrine sweat production. [provided by RefSeq, Apr 2015]

Uniprot Description

IP3R2: a multi-pass endoplasmic reticulum membrane receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium. This release is regulated by cAMP both dependently and independently of PKA. Most normal tissues displayed weak to moderate cytoplasmic positivity. Strong staining was observed in the gastrointestinal tract, hepatocytes and exocrine pancreas. Short isoform Is found in skeletal muscle and heart. The receptor contains a calcium channel in its C-terminal extremity. Its large N-terminal cytoplasmic region has the ligand-binding site in the N-terminus and modulatory sites in the middle portion immediately upstream of the channel region. Phosphorylation by PKA increases calcium release. Calcium appears to inhibit ligand binding to the receptor, most probably by interacting with a distinct calcium-binding protein which then inhibits the receptor. Belongs to the InsP3 receptor family. 2 isoforms of the human protein are produced by alternative splicing. The short isoform is found in skeletal muscle and heart.

Protein type: Membrane protein, multi-pass; Channel, calcium; Membrane protein, integral; Channel, ligand-gated

Chromosomal Location of Human Ortholog: 12p11

Cellular Component: endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; membrane; plasma membrane; integral to membrane; cell cortex; receptor complex

Molecular Function: calcium ion transmembrane transporter activity; phosphoinositide binding; inositol 1,4,5-triphosphate-sensitive calcium-release channel activity

Biological Process: epidermal growth factor receptor signaling pathway; platelet activation; inositol phosphate-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; signal transduction; transport; phospholipase C activation; response to hypoxia; energy reserve metabolic process; innate immune response; blood coagulation; vascular endothelial growth factor receptor signaling pathway; regulation of insulin secretion

Disease: Anhidrosis, Isolated, With Normal Sweat Glands

Research Articles on ITPR2

Similar Products

Product Notes

The ITPR2 itpr2 (Catalog #AAA3202419) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITPR2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ITPR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITPR2 itpr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRDCLFKVCP MNRYSAQKQY WKAKQAKQGN HTEAALLKKL QHAAELEQKQ. It is sometimes possible for the material contained within the vial of "ITPR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.