Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ITLN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit ITLN1 Polyclonal Antibody | anti-ITLN1 antibody

ITLN1 antibody - middle region

Gene Names
ITLN1; HL1; LFR; HL-1; INTL; ITLN; hIntL; omentin
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ITLN1; Polyclonal Antibody; ITLN1 antibody - middle region; anti-ITLN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANA
Sequence Length
313
Applicable Applications for anti-ITLN1 antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ITLN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ITLN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ITLN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-ITLN1 antibody
This is a rabbit polyclonal antibody against ITLN1. It was validated on Western Blot

Target Description: ITLN1 has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes.ITLN1 increases AKT phosphorylation in the absence and presence of insulin. ITLN1 may play a role in the defense system against microorganisms. ITLN1 may specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosyl residues, in a calcium-dependent manner. ITLN1 may be involved in iron metabolism.
Product Categories/Family for anti-ITLN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
intelectin-1
NCBI Official Synonym Full Names
intelectin 1
NCBI Official Symbol
ITLN1
NCBI Official Synonym Symbols
HL1; LFR; HL-1; INTL; ITLN; hIntL; omentin
NCBI Protein Information
intelectin-1
UniProt Protein Name
Intelectin-1
Protein Family
UniProt Gene Name
ITLN1
UniProt Synonym Gene Names
INTL; ITLN; LFR; ITLN-1
UniProt Entry Name
ITLN1_HUMAN

Uniprot Description

ITLN1: Has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. Increases AKT phosphorylation in the absence and presence of insulin. May play a role in the defense system against microorganisms. May specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosyl residues, in a calcium-dependent manner. May be involved in iron metabolism.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: brush border membrane; receptor complex; lipid raft

Molecular Function: carbohydrate binding

Biological Process: positive regulation of glucose import; response to nematode; positive regulation of protein amino acid phosphorylation

Research Articles on ITLN1

Similar Products

Product Notes

The ITLN1 itln1 (Catalog #AAA3205944) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITLN1 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ITLN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITLN1 itln1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WTDNGPVIPV VYDFGDAQKT ASYYSPYGQR EFTAGFVQFR VFNNERAANA. It is sometimes possible for the material contained within the vial of "ITLN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.