Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ISL1Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ISL1 Polyclonal Antibody | anti-ISL1 antibody

ISL1 Antibody - C-terminal region

Gene Names
ISL1; Isl-1; ISLET1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ISL1; Polyclonal Antibody; ISL1 Antibody - C-terminal region; anti-ISL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP
Sequence Length
349
Applicable Applications for anti-ISL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ISL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ISL1Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ISL1Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ISL1 antibody
This is a rabbit polyclonal antibody against ISL1. It was validated on Western Blot

Target Description: ISL1 is a member of the LIM/homeodomain family of transcription factors. It binds to the enhancer region of the insulin gene, among others, and may play an important role in regulating insulin gene expression. ISL1 is central to the development of pancreatic cell lineages and may also be required for motor neuron generation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
insulin gene enhancer protein ISL-1
NCBI Official Synonym Full Names
ISL LIM homeobox 1
NCBI Official Symbol
ISL1
NCBI Official Synonym Symbols
Isl-1; ISLET1
NCBI Protein Information
insulin gene enhancer protein ISL-1
UniProt Protein Name
Insulin gene enhancer protein ISL-1
UniProt Gene Name
ISL1
UniProt Synonym Gene Names
Islet-1
UniProt Entry Name
ISL1_HUMAN

NCBI Description

This gene encodes a member of the LIM/homeodomain family of transcription factors. The encoded protein binds to the enhancer region of the insulin gene, among others, and may play an important role in regulating insulin gene expression. The encoded protein is central to the development of pancreatic cell lineages and may also be required for motor neuron generation. Mutations in this gene have been associated with maturity-onset diabetes of the young. [provided by RefSeq, Jul 2008]

Uniprot Description

ISL1: Binds to one of the cis-acting domain of the insulin gene enhancer.

Protein type: Cell development/differentiation; Nuclear receptor co-regulator; DNA-binding; Transcription factor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5q11.1

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; nucleus

Molecular Function: ligand-dependent nuclear receptor binding; zinc ion binding; bHLH transcription factor binding; estrogen receptor binding; chromatin binding

Biological Process: positive regulation of granulocyte macrophage colony-stimulating factor production; positive regulation of interleukin-12 production; positive regulation of interleukin-1 alpha production; negative regulation of transcription from RNA polymerase II promoter; positive regulation of tyrosine phosphorylation of Stat3 protein; negative regulation of estrogen receptor signaling pathway; pancreas development; positive regulation of cell proliferation; ventricular cardiac muscle morphogenesis; neuron fate specification; negative regulation of neuron apoptosis; sensory system development; neural crest cell migration; positive regulation of DNA binding; trigeminal nerve development; pharyngeal system development; axon regeneration; spinal cord motor neuron cell fate specification; positive regulation of insulin secretion; positive regulation of interleukin-6 production; spinal cord motor neuron differentiation; positive regulation of tumor necrosis factor production; positive regulation of interleukin-1 beta production; positive regulation of interferon-gamma production; negative regulation of neuron differentiation; positive regulation of angiogenesis; mesenchymal cell differentiation; visceral motor neuron differentiation; pituitary gland development; negative regulation of inflammatory response; positive regulation of transcription from RNA polymerase II promoter; peripheral nervous system neuron axonogenesis; retinal ganglion cell axon guidance

Research Articles on ISL1

Similar Products

Product Notes

The ISL1 isl1 (Catalog #AAA3200383) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ISL1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ISL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ISL1 isl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IMMKQLQQQQ PNDKTNIQGM TGTPMVAASP ERHDGGLQAN PVEVQSYQPP. It is sometimes possible for the material contained within the vial of "ISL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.