IRF5 Polyclonal Antibody | anti-IRF5 antibody

Anti-IRF5 Antibody

Cat. Num. AAA177798

• Gene Names: IRF5; SLEB10
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: IRF5; Polyclonal Antibody; Anti-IRF5 Antibody; Interferon regulatory factor 5; Interferon regulatory factor 5 bone marrow variant; IRF 5; IRF-5; Irf5; IRF5_HUMAN; SLEB10; interferon regulatory factor 5; anti-IRF5 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 498

• Applicable Applications for anti-IRF5 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442-472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ), different from the related mouse sequence by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- IRF5 Picoband antibody, MBS177798, Western blottingAll lanes: Anti IRF5 (MBS177798) at 0.5ug/mlLane 1: Rat Intestine Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: NIH3T3 Whole Cell Lysate at 40ugLane 5: HEPA Whole Cell Lysate at 40ugPredicted bind size: 56KDObserved bind size: 56KD)

Immunohistochemistry (IHC)

(Anti- IRF5 Picoband antibody, MBS177798, IHC(P)IHC(P): Mouse Spleen Tissue )

Immunohistochemistry (IHC)

(Anti- IRF5 Picoband antibody, MBS177798, IHC(P)IHC(P): Rat Spleen Tissue )

Immunohistochemistry (IHC)

(Anti- IRF5 Picoband antibody, MBS177798, IHC(P)IHC(P): Human Mammary Cancer Tissue )

Related Product Information for anti-IRF5 antibody

Description: Rabbit IgG polyclonal antibody for Interferon regulatory factor 5(IRF5) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. IRF5 gene is mapped to 7q32.1. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Multiple transcript variants encoding different isoforms have been found for this gene, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. This gene is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection.

References

1. Couzinet, A., Tamura, K., Chen, H., Nishimura, K., Wang, Z., Morishita, Y., Takeda, K., Yagita, H., Yanai, H., Taniguchi, T., Tamura, T. A cell-type-specific requirement for IFN regulatory factor 5 (IRF5) in Fas-induced apoptosis. Proc. Nat. Acad. Sci. 105: 2556-2561, 2008. 2. Sigurdsson, S., Goring, H. H. H., Kristjansdottir, G., Milani, L., Nordmark, G., Sandling, J. K., Eloranta, M.-L., Feng, D., Sangster-Guity, N., Gunnarsson, I., Svenungsson, E., Sturfelt, G., Jonsen, A., Truedsson, L., Barnes, B. J., Alm, G., Ronnblom, L., Syvanen, A.-C. Comprehensive evaluation of the genetic variants of interferon regulatory growth factor 5 (IRF5) reveals a novel 5 bp length polymorphism as strong risk factor for systemic lupus erythematosus. Hum. Molec. Genet. 17: 872-881, 2008.

NCBI and Uniprot Product Information

• NCBI GI #: 291190719
• NCBI GeneID: 3663
• NCBI Accession #: NP_001092097.2
• NCBI GenBank Nucleotide #: NM_001098627.3
• UniProt Accession #: Q13568; Q1A7B4; Q64GA9; Q64GB1; Q64GB2; Q6RCM8; Q9BQF0; A4D1J8; A8DUA8; A8DUA9; E7EQ16; E7EW54
• Molecular Weight: 17,020 Da
• NCBI Official Full Name: interferon regulatory factor 5 isoform b
• NCBI Official Synonym Full Names: interferon regulatory factor 5
• NCBI Official Symbol: IRF5
• NCBI Official Synonym Symbols: SLEB10
• NCBI Protein Information: interferon regulatory factor 5
• UniProt Protein Name: Interferon regulatory factor 5
• Protein Family: Interferon regulatory factor
• UniProt Gene Name: IRF5
• UniProt Synonym Gene Names: IRF-5
• UniProt Entry Name: IRF5_HUMAN

NCBI Description

This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Multiple transcript variants encoding different isoforms have been found for this gene, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. [provided by RefSeq, Mar 2010]

Uniprot Description

IRF5: Transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. Activated by TLR7 or TLR8 signaling. Homodimer, when phosphorylated. Belongs to the IRF family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 7q32

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: protein binding; transcription factor activity

Biological Process: defense response to virus; positive regulation of apoptosis; positive regulation of interferon-alpha production; positive regulation of interferon-beta production; positive regulation of interleukin-12 production; positive regulation of transcription from RNA polymerase II promoter; response to muramyl dipeptide; response to peptidoglycan; transcription, DNA-dependent

Disease: Inflammatory Bowel Disease 14; Systemic Lupus Erythematosus, Susceptibility To, 10