Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IPO9Sample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human IPO9 Polyclonal Antibody | anti-IPO9 antibody

IPO9 Antibody - C-terminal region

Gene Names
IPO9; Imp9
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IPO9; Polyclonal Antibody; IPO9 Antibody - C-terminal region; anti-IPO9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARQATPAEWSQDDSNDMWEDQEEEEEEEEDGLAGQLLSDILATSKYEEDY
Sequence Length
1041
Applicable Applications for anti-IPO9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human IPO9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IPO9Sample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IPO9Sample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-IPO9 antibody
Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of H2B histone (By similarity), RPS7 and RPL18A. Prevents the cytoplasmic aggregation of RPS7 and RPL18A by shielding exposed basic domains. May also import H2A, H3, H4 histones (By similarity), RPL4 and RPL6.
Product Categories/Family for anti-IPO9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115 kDa
NCBI Official Full Name
importin-9
NCBI Official Synonym Full Names
importin 9
NCBI Official Symbol
IPO9
NCBI Official Synonym Symbols
Imp9
NCBI Protein Information
importin-9
UniProt Protein Name
Importin-9
Protein Family
UniProt Gene Name
IPO9
UniProt Synonym Gene Names
IMP9; KIAA1192; RANBP9; Imp9; RanBP9
UniProt Entry Name
IPO9_HUMAN

Uniprot Description

IPO9: Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran- dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates the nuclear import of H2B histone, RPS7 and RPL18A. Prevents the cytoplasmic aggregation of RPS7 and RPL18A by shielding exposed basic domains. May also import H2A, H3, H4 histones, RPL4 and RPL6. Belongs to the importin beta family.

Protein type: Nuclear import; Karyopherin

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: membrane; cytoplasm; nucleus

Molecular Function: protein binding; histone binding; Ran GTPase binding; protein transporter activity

Biological Process: protein import into nucleus

Research Articles on IPO9

Similar Products

Product Notes

The IPO9 ipo9 (Catalog #AAA3221397) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IPO9 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IPO9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IPO9 ipo9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARQATPAEWS QDDSNDMWED QEEEEEEEED GLAGQLLSDI LATSKYEEDY. It is sometimes possible for the material contained within the vial of "IPO9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.