Rabbit anti-Human, Rat Insulin Receptor Polyclonal Antibody | anti-INSR antibody

Anti-Insulin Receptor Antibody

Cat. Num. AAA178828

• Gene Names: INSR; HHF5; CD220
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Immunogen affinity purified.
• Synonyms: Insulin Receptor; Polyclonal Antibody; Anti-Insulin Receptor Antibody; CD 220; CD220; HHF5; HIR A; insulin receptor; INSR alpha; insulin receptor a; Insulin Receptor alpha; Insulin receptor subunit alpha; Insulin receptor subunit beta; Insulin receptor(IR); InsulinReceptor; Insulinreceptor(IR); IR 1; P06213; anti-INSR antibody

• Host: Rabbit
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 1382

• Applicable Applications for anti-INSR antibody: Western Blot (WB)
• Application Notes: Western Blot: 0.1-0.5ug/ml
• Notes: Tested Species: In-house tested species with positive results.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Insulin Receptor (38-76aa MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL), identical to the related mouse and rat sequences.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Insulin Receptor expression in rat kidney extract (lane 1) and HEPG2 whole cell lysates (lane 2). Insulin Receptor at 155KD was detected using rabbit anti- Insulin Receptor Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Related Product Information for anti-INSR antibody

Rabbit IgG polyclonal antibody for Insulin receptor(INSR) detection.
Background: INSR(INSULIN RECEPTOR) is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.

References

1. Accili, D., Drago, J., Lee, E. J., Johnson, M. D., Cool, M. H., Salvatore, P., Asico, L. D., Jose, P. A., Taylor, S. I., Westphal, H. Early neonatal death in mice homozygous for a null allele of the insulin receptor gene. Nature Genet. 12: 106-109, 1996.
2. 't Hart, L. M., Stolk, R. P., Dekker, J. M., Nijpels, G., Grobbee, D. E., Heine, R. J., Maassen, J. A. Prevalence of variants in candidate genes for type 2 diabetes mellitus in the Netherlands: the Rotterdam study and the Hoorn study. J. Clin. Endocr. Metab. 84: 1002-1006, 1999.
3. Ward CW, Lawrence MC (April 2009). "Ligand-induced activation of the insulin receptor: a multi-step process involving structural changes in both the ligand and the receptor".

NCBI and Uniprot Product Information

• NCBI GI #: 119395736
• NCBI GeneID: 3643
• NCBI Accession #: NP_000199.2
• NCBI GenBank Nucleotide #: NM_000208.3
• UniProt Accession #: P06213; Q17RW0; Q59H98; Q9UCB7; Q9UCB8; Q9UCB9
• Molecular Weight: 155,146 Da
• NCBI Official Full Name: insulin receptor isoform Long preproprotein
• NCBI Official Synonym Full Names: insulin receptor
• NCBI Official Symbol: INSR
• NCBI Official Synonym Symbols: HHF5; CD220
• NCBI Protein Information: insulin receptor
• UniProt Protein Name: Insulin receptor
• Protein Family: Insulin receptor
• UniProt Gene Name: INSR
• UniProt Synonym Gene Names: IR

NCBI Description

This gene encodes a member of the receptor tyrosine kinase family of proteins. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form a heterotetrameric receptor. Binding of insulin or other ligands to this receptor activates the insulin signaling pathway, which regulates glucose uptake and release, as well as the synthesis and storage of carbohydrates, lipids and protein. Mutations in this gene underlie the inherited severe insulin resistance syndromes including type A insulin resistance syndrome, Donohue syndrome and Rabson-Mendenhall syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

Uniprot Description

INSR: a receptor tyrosine kinase that mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 domain) that specifically recognize different phosphotyrosines residues, including the p85 regulatory subunit of PI3K and SHP2. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT pathway, which is responsible for most of the metabolic actions of insulin, and the Ras-MAPK pathway, which regulates expression of some genes and cooperates with the PI3K pathway to control cell growth and differentiation. In addition to binding insulin, the insulin receptor can bind insulin-like growth factors (IGFI and IGFII). The holoenzyme is cleaved into two chains, the alpha and beta subunits. The active complex is a tetramer containing 2 alpha and 2 beta chains linked by disulfide bonds. The alpha chains constitute the ligand- binding domain, while the beta chains carry the kinase domain. Interacts with SORBS1 but dissociates from it following insulin stimulation. Familial mutations associated with insulin resistant diabetes, acanthosis nigricans, pineal hyperplasia, and polycystic ovary syndrome. SNP variants may be associated with polycystic ovary syndrome, atypical migraine and diabetic hyperlipidemia. Mutations also cause leprechaunism, a severe insulin resistance syndrome causing growth retardation and death in early infancy. Two isoforms of the human protein are produced by alternative splicing. The Short isoform has a higher affinity for insulin than the longer. Isoform Long and isoform Short are predominantly expressed in tissue targets of insulin metabolic effects: liver, adipose tissue and skeletal muscle but are also expressed in the peripheral nerve, kidney, pulmonary alveoli, pancreatic acini, placenta vascular endothelium, fibroblasts, monocytes, granulocytes, erythrocytes and skin. Isoform Short is preferentially expressed in fetal cells such as fetal fibroblasts, muscle, liver and kidney. Found as a hybrid receptor with IGF1R in muscle, heart, kidney, adipose tissue, skeletal muscle, hepatoma, fibroblasts, spleen and placenta. Overexpressed in several tumors, including breast, colon, lung, ovary, and thyroid carcinomas.

Protein type: EC 2.7.10.1; InsR family; Kinase, protein; Membrane protein, integral; Protein kinase, TK; Protein kinase, tyrosine (receptor); TK group

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: caveola; endosome membrane; integral to plasma membrane; intracellular membrane-bound organelle; membrane; plasma membrane; receptor complex

Molecular Function: ATP binding; GTP binding; insulin binding; insulin receptor activity; insulin receptor substrate binding; insulin-like growth factor I binding; insulin-like growth factor II binding; insulin-like growth factor receptor binding; phosphoinositide 3-kinase binding; protein binding; protein-tyrosine kinase activity; PTB domain binding; receptor signaling protein tyrosine kinase activity

Biological Process: activation of MAPK activity; activation of protein kinase activity; activation of protein kinase B; cellular response to insulin stimulus; G-protein coupled receptor protein signaling pathway; glucose homeostasis; heart morphogenesis; insulin receptor signaling pathway; peptidyl-tyrosine phosphorylation; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of developmental growth; positive regulation of DNA replication; positive regulation of glucose import; positive regulation of glycogen biosynthetic process; positive regulation of glycolysis; positive regulation of MAPKKK cascade; positive regulation of mitosis; positive regulation of nitric oxide biosynthetic process; positive regulation of protein amino acid phosphorylation; positive regulation of protein kinase B signaling cascade; protein amino acid autophosphorylation; protein heterotetramerization; regulation of embryonic development; regulation of transcription, DNA-dependent; transformation of host cell by virus

Disease: Diabetes Mellitus, Insulin-resistant, With Acanthosis Nigricans; Donohue Syndrome; Hyperinsulinemic Hypoglycemia, Familial, 5; Pineal Hyperplasia, Insulin-resistant Diabetes Mellitus, And Somatic Abnormalities