Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-INSR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Insr Polyclonal Antibody | anti-INSR antibody

Insr antibody - middle region

Gene Names
Insr; IR; IR-A; IR-B; CD220; 4932439J01Rik; D630014A15Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Insr; Polyclonal Antibody; Insr antibody - middle region; anti-INSR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPY
Sequence Length
1372
Applicable Applications for anti-INSR antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-INSR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-INSR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-Insr AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)

Western Blot (WB) (WB Suggested Anti-Insr AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)
Related Product Information for anti-INSR antibody
This is a rabbit polyclonal antibody against Insr. It was validated on Western Blot

Target Description: This receptor binds insulin and has a tyrosine-protein kinase activity. When it is present in a hybrid receptor with IGF1R, binds IGF1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
155kDa
NCBI Official Full Name
insulin receptor isoform A preproprotein
NCBI Official Synonym Full Names
insulin receptor
NCBI Official Symbol
Insr
NCBI Official Synonym Symbols
IR; IR-A; IR-B; CD220; 4932439J01Rik; D630014A15Rik
NCBI Protein Information
insulin receptor
UniProt Protein Name
Insulin receptor
Protein Family
UniProt Gene Name
Insr
UniProt Synonym Gene Names
IR
UniProt Entry Name
INSR_MOUSE

NCBI Description

This gene encodes a member of the receptor tyrosine kinase family of transmembrane signaling proteins that play important roles in cell differentiation, growth and metabolism. The encoded preproprotein undergoes proteolytic processing to generate alpha and beta chains that form a disulfide-linked heterodimer which, in turn homodimerizes to form a mature, functional receptor. Mice lacking the encoded protein develop severe hyperglycemia and hyperketonemia, and die within a couple of days after birth as a result of diabetic ketoacidosis. [provided by RefSeq, Aug 2016]

Uniprot Description

INSR: a receptor tyrosine kinase that mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 domain) that specifically recognize different phosphotyrosines residues, including the p85 regulatory subunit of PI3K and SHP2. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT pathway, which is responsible for most of the metabolic actions of insulin, and the Ras-MAPK pathway, which regulates expression of some genes and cooperates with the PI3K pathway to control cell growth and differentiation. In addition to binding insulin, the insulin receptor can bind insulin-like growth factors (IGFI and IGFII). The holoenzyme is cleaved into two chains, the alpha and beta subunits. The active complex is a tetramer containing 2 alpha and 2 beta chains linked by disulfide bonds. The alpha chains constitute the ligand- binding domain, while the beta chains carry the kinase domain. Interacts with SORBS1 but dissociates from it following insulin stimulation. Familial mutations associated with insulin resistant diabetes, acanthosis nigricans, pineal hyperplasia, and polycystic ovary syndrome. SNP variants may be associated with polycystic ovary syndrome, atypical migraine and diabetic hyperlipidemia. Mutations also cause leprechaunism, a severe insulin resistance syndrome causing growth retardation and death in early infancy. Two isoforms of the human protein are produced by alternative splicing. The Short isoform has a higher affinity for insulin than the longer. Isoform Long and isoform Short are predominantly expressed in tissue targets of insulin metabolic effects: liver, adipose tissue and skeletal muscle but are also expressed in the peripheral nerve, kidney, pulmonary alveoli, pancreatic acini, placenta vascular endothelium, fibroblasts, monocytes, granulocytes, erythrocytes and skin. Isoform Short is preferentially expressed in fetal cells such as fetal fibroblasts, muscle, liver and kidney. Found as a hybrid receptor with IGF1R in muscle, heart, kidney, adipose tissue, skeletal muscle, hepatoma, fibroblasts, spleen and placenta. Overexpressed in several tumors, including breast, colon, lung, ovary, and thyroid carcinomas.

Protein type: EC 2.7.10.1; Protein kinase, TK; Kinase, protein; Membrane protein, integral; Protein kinase, tyrosine (receptor); TK group; InsR family

Cellular Component: membrane; intracellular membrane-bound organelle; integral to plasma membrane; integral to membrane; plasma membrane; synapse; caveola; nucleus; cytosol; endosome; receptor complex

Molecular Function: protein domain specific binding; GTP binding; PTB domain binding; nucleotide binding; transmembrane receptor protein tyrosine kinase activity; receptor signaling protein tyrosine kinase activity; insulin-like growth factor II binding; protein kinase binding; protein phosphatase binding; lipoic acid binding; protein kinase activity; transferase activity; insulin binding; insulin-like growth factor receptor binding; protein binding; insulin-like growth factor I binding; insulin receptor substrate binding; 3-phosphoinositide-dependent protein kinase binding; protein-tyrosine kinase activity; transferase activity, transferring phosphorus-containing groups; protein complex binding; phosphoinositide 3-kinase binding; kinase activity; ATP binding; insulin receptor activity

Biological Process: heart morphogenesis; epidermis development; positive regulation of nitric oxide biosynthetic process; peptidyl-tyrosine phosphorylation; activation of MAPK activity; protein amino acid autophosphorylation; positive regulation of glycogen biosynthetic process; regulation of embryonic development; exocrine pancreas development; glucose homeostasis; protein amino acid phosphorylation; positive regulation of glucose import; positive regulation of MAPKKK cascade; negative regulation of protein amino acid phosphorylation; regulation of transcription, DNA-dependent; male sex determination; positive regulation of cell proliferation; protein heterotetramerization; regulation of hydrogen peroxide metabolic process; positive regulation of developmental growth; positive regulation of mitosis; activation of protein kinase B; positive regulation of protein kinase B signaling cascade; G-protein coupled receptor protein signaling pathway; organ morphogenesis; cellular response to insulin stimulus; positive regulation of glycolysis; activation of protein kinase activity; insulin receptor signaling pathway; positive regulation of protein amino acid phosphorylation; phosphorylation; negative regulation of transporter activity; positive regulation of DNA replication; positive regulation of phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; transformation of host cell by virus; positive regulation of cell migration

Research Articles on INSR

Similar Products

Product Notes

The INSR insr (Catalog #AAA3205806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Insr antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Insr can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the INSR insr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEVSGTKGRQ ERNDIALKTN GDQASCENEL LKFSFIRTSF DKILLRWEPY. It is sometimes possible for the material contained within the vial of "Insr, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.