Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: ILKSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit ILK Polyclonal Antibody | anti-ILK antibody

ILK Antibody - C-terminal region

Gene Names
ILK; P59; ILK-1; ILK-2; p59ILK; HEL-S-28
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ILK; Polyclonal Antibody; ILK Antibody - C-terminal region; anti-ILK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD
Sequence Length
452
Applicable Applications for anti-ILK antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 82%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ILK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: ILKSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: ILKSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-ILK antibody
This is a rabbit polyclonal antibody against ILK. It was validated on Western Blot

Target Description: Transduction of extracellular matrix signals through integrins influences intracellular and extracellular functions, and appears to require interaction of integrin cytoplasmic domains with cellular proteins. Integrin-linked kinase (ILK), interacts with the cytoplasmic domain of beta-1 integrin. This gene encodes a serine/threonine protein kinase with 4 ankyrin-like repeats, which associates with the cytoplasmic domain of beta integrins and acts as a proximal receptor kinase regulating integrin-mediated signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
integrin-linked protein kinase isoform 1
NCBI Official Synonym Full Names
integrin linked kinase
NCBI Official Symbol
ILK
NCBI Official Synonym Symbols
P59; ILK-1; ILK-2; p59ILK; HEL-S-28
NCBI Protein Information
integrin-linked protein kinase
UniProt Protein Name
Integrin-linked protein kinase
UniProt Gene Name
ILK
UniProt Synonym Gene Names
ILK1; ILK2
UniProt Entry Name
ILK_HUMAN

NCBI Description

This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of this protein is important in the epithelial to mesenchymal transition, and over-expression of this gene is implicated in tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]

Uniprot Description

ILK: a tyrosine kinase-like kinase of the MLK family. Couples integrins and growth factors to downstream pathways involved in cell survival, cell cycle control, cell-cell adhesion and cell motility. Functions as a scaffold bridging the extra-cellular matrix and growth factor receptors to the actin cytoskeleton through interactions with the ILK-PINCH complex. This complex, which includes integrin, PINCH (which links ILK to receptor tyrosine kinases via Nck2), PARVA and affixin, is considered to be one of the convergence points of integrin- and growth factor-signaling pathways. May be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Stimulated downstream of PI3 kinase. Increased expression is correlated with progression of several tumor types, including breast, prostate, and colon carcinomas. Overexpression drives anchorage-independent growth and faster cell cycle.

Protein type: EC 2.7.11.1; Kinase, protein; Protein kinase, TKL; Protein kinase, Ser/Thr (non-receptor); TKL group; MLK family; ILK subfamily

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: protein complex; costamere; focal adhesion; terminal button; intercellular junction; cytosol; nucleoplasm; sarcomere; membrane; cell soma; lamellipodium; cytoplasm; plasma membrane; stress fiber; dendritic shaft; cell junction

Molecular Function: integrin binding; protein serine/threonine kinase activity; protein binding; signal transducer activity; SH3 domain binding; protein kinase binding; ATP binding

Biological Process: negative regulation of smooth muscle cell proliferation; protein heterooligomerization; cell-matrix adhesion; positive regulation of axon extension; positive regulation of transcription, DNA-dependent; negative regulation of smooth muscle cell migration; protein amino acid phosphorylation; myelin formation; positive regulation of MAP kinase activity; positive regulation of cell proliferation; fibril organization and biogenesis; protein kinase B signaling cascade; negative regulation of neuron apoptosis; cell cycle arrest; positive regulation of cell-matrix adhesion; positive regulation of BMP signaling pathway; integrin-mediated signaling pathway; cell aging; positive regulation of dendrite morphogenesis; positive regulation of myoblast differentiation; myelination in the peripheral nervous system; establishment and/or maintenance of epithelial cell polarity; cell proliferation; positive regulation of osteoblast differentiation; positive regulation of protein kinase B signaling cascade; peptidyl-serine phosphorylation; ureteric bud branching; regulation of actin cytoskeleton organization and biogenesis; negative regulation of protein kinase activity; nerve development; positive regulation of phosphorylation; neurite morphogenesis; positive regulation of cell migration

Research Articles on ILK

Similar Products

Product Notes

The ILK ilk (Catalog #AAA3200235) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ILK Antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ILK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ILK ilk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKVALEGLRP TIPPGISPHV CKLMKICMNE DPAKRPKFDM IVPILEKMQD. It is sometimes possible for the material contained within the vial of "ILK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.