Rabbit anti-Human IL32 Polyclonal Antibody | anti-IL32 antibody

IL32 (Interleukin-32, Natural Killer Cells Protein 4, Tumor Necrosis Factor alpha-inducing Factor, IL-32, NK4, TAIF) APC

Cat. Num. AAA6382806

• Gene Names: IL32; NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IL32; Polyclonal Antibody; IL32 (Interleukin-32; Natural Killer Cells Protein 4; Tumor Necrosis Factor alpha-inducing Factor; IL-32; NK4; TAIF) APC; anti-IL32 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human IL32.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 929

• Applicable Applications for anti-IL32 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human IL32, aa1-188 (NP_001012649)
• Immunogen Sequence: MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IL32 rabbit polyclonal antibody. Western Blot analysis of IL32 expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of IL32 expression in transfected 293T cell line by IL32 polyclonal antibody. Lane 1: IL32 transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-IL32 antibody

Interleukin-32 (IL-32) was initially identified as a transcript (NK4) selectively expressed in lymphocytes and NK cells, whose expression is increased following activation by IL-2. It was later re-isolated from an IL-18-treated lung carcinoma cell line and re-named IL-32. IL-32 is unusual in that it does not share sequence homology with known cytokine families and is highly expressed in immune tissues, existing in at least four differentially spliced isoforms. Because treatment of human monocytic and mouse macrophage cells with IL-32 induces several proinflammatory cytokines such as TNF-a, IL-8 and MIP-2, and because it is induced in human peripheral lymphocyte cells after mitogen stimulation and in epithelial cells by IFNg, it has been suggested that IL-32 may play a role in autoimmune and inflammatory diseases such as rheumatoid arthritis.

Product Categories/Family for anti-IL32 antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 1779421267
• NCBI GeneID: 9235
• NCBI Accession #: NM_001012631.4
• NCBI GenBank Nucleotide #: NM_001012631
• NCBI Official Full Name: Homo sapiens interleukin 32 (IL32), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: interleukin 32
• NCBI Official Symbol: IL32
• NCBI Official Synonym Symbols: NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma
• NCBI Protein Information: interleukin-32
• Protein Family: Interleukin

NCBI Description

This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]