Western Blot (WB)
(IL28R alpha antibody (MBS839920) used at 1 ug/ml to detect target protein.)
Rabbit IL28R alpha Polyclonal Antibody | anti-IL28R alpha antibody
IL28R alpha antibody
Applications
Western Blot
Purity
Affinity purified
Synonyms
IL28R alpha; Polyclonal Antibody; IL28R alpha antibody; Polyclonal IL28R alpha; Anti-IL28R alpha; IL28RA; ILRa-28; il-28r1; IL28Ra; ILRa 28; IFNLR1; Interferon Lambda Receptor; CRF2/12; IFNLR; Interleukin 28 Receptor Alpha; LICR2; anti-IL28R alpha antibody
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL28RA antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-IL28R alpha antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B.
Cross-Reactivity
Human
Immunogen
IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(IL28R alpha antibody (MBS839920) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(IL28R alpha antibody (MBS839920) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-IL28R alpha antibody
Rabbit polyclonal IL28R alpha antibody
Product Categories/Family for anti-IL28R alpha antibody
Similar Products
Product Notes
The IL28R alpha (Catalog #AAA839920) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IL28R alpha can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the IL28R alpha for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL28R alpha, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
