Rabbit anti-Human IL23A Polyclonal Antibody | anti-IL23A antibody

IL23A (Interleukin-23 Subunit alpha, IL-23 Subunit alpha, IL-23-A, Interleukin-23 Subunit p19, IL-23p19, SGRF, UNQ2498/PRO5798, MGC79388, P19, SGRF) (HRP)

Cat. Num. AAA6382754

• Gene Names: IL23A; P19; SGRF; IL-23; IL-23A; IL23P19
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IL23A; Polyclonal Antibody; IL23A (Interleukin-23 Subunit alpha; IL-23 Subunit alpha; IL-23-A; Interleukin-23 Subunit p19; IL-23p19; SGRF; UNQ2498/PRO5798; MGC79388; P19; SGRF) (HRP); anti-IL23A antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human IL23A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-IL23A antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length protein corresponding to aa1-189 of human IL23A.
• Immunogen Sequence: MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IL23A expression in transfected 293T cell line by 128451. Lane 1: IL23A transfected lysate (20.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-IL23A antibody

This monoclonal antibody recognizes human IL-23, a heterodimeric cytokine composed of the p40 subunit shared with IL-12 and a specific p19 subunit. This antibody recognizes heterodimeric IL-23, but does not react with the p40 subunit alone or recombinant IL-12(p70) when used as a capture antibody in ELISA. IL-23 is secreted by activated dendritic cells and macrophages and has been shown to enhance IFN-y secretion by memory (CD45RO) T cells in an IL-2 dependent manner. IL-23 may also induce unique Th subset (designated ThIL-17) that secretes the cytokines IL-17, IL-6, TNF and low levels of IFN-y. IL-23 has been shown to promote immunity to mycobacteria and has been shown to be upregulated in response to some viral infections and in psoriatic lesions. IL-23 binds to the IL-23 receptor comprised of a B1 subunit shared with the IL-12 receptor and IL-23-specific subunit.

Product Categories/Family for anti-IL23A antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 7706702
• NCBI GeneID: 51561
• NCBI Accession #: NP_057668.1
• NCBI GenBank Nucleotide #: NM_016584
• UniProt Accession #: Q9NPF7; Q6NZ80; Q6NZ82; Q9H2A5
• Molecular Weight: 20,730 Da
• NCBI Official Full Name: interleukin-23 subunit alpha
• NCBI Official Synonym Full Names: interleukin 23, alpha subunit p19
• NCBI Official Symbol: IL23A
• NCBI Official Synonym Symbols: P19; SGRF; IL-23; IL-23A; IL23P19
• NCBI Protein Information: interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; IL-23p19; JKA3 induced upon T-cell activation; interleukin 23 p19 subunit; interleukin-23 subunit p19; interleukin-six, G-CSF related factor
• UniProt Protein Name: Interleukin-23 subunit alpha
• Protein Family: Interleukin
• UniProt Gene Name: IL23A
• UniProt Synonym Gene Names: SGRF; IL-23 subunit alpha; IL-23-A; IL-23p19
• UniProt Entry Name: IL23A_HUMAN

NCBI Description

This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. [provided by RefSeq, Jul 2008]

Uniprot Description

IL23A: Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak- Stat signaling cascade, stimulates memory rather than naive T- cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis. Belongs to the IL-6 superfamily.

Protein type: Cytokine; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 12q13.3

Molecular Function: protein binding; interleukin-23 receptor binding; cytokine activity

Biological Process: positive regulation of granulocyte macrophage colony-stimulating factor production; positive regulation of T-helper 1 type immune response; negative regulation of interleukin-10 production; positive regulation of interleukin-12 production; positive regulation of osteoclast differentiation; positive regulation of T cell mediated cytotoxicity; tissue remodeling; positive regulation of NK T cell proliferation; positive regulation of tyrosine phosphorylation of Stat4 protein; positive regulation of NF-kappaB import into nucleus; positive regulation of activated T cell proliferation; defense response to Gram-negative bacterium; positive regulation of natural killer cell activation; positive regulation of interleukin-10 production; positive regulation of tyrosine phosphorylation of Stat3 protein; T cell proliferation; positive regulation of T cell proliferation; inflammatory response; defense response to virus; positive regulation of memory T cell differentiation; positive regulation of interleukin-17 production; positive regulation of NK T cell activation; positive regulation of natural killer cell proliferation; positive regulation of tumor necrosis factor production; regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of interferon-gamma production; positive regulation of tissue remodeling; positive regulation of tyrosine phosphorylation of Stat5 protein; innate immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of defense response to virus by host; positive regulation of inflammatory response