Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IL21 rabbit polyclonal antibody. Western Blot analysis of IL21 expression in human liver.)

Rabbit anti-Human, Mouse IL21 Polyclonal Antibody | anti-IL21 antibody

IL21 (Interleukin-21, IL-21, Za11, Interleukin21) (HRP)

Gene Names
IL21; Za11; IL-21
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL21; Polyclonal Antibody; IL21 (Interleukin-21; IL-21; Za11; Interleukin21) (HRP); anti-IL21 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IL21. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-IL21 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human IL21, aa1-162 (NP_068575.1).
Immunogen Sequence
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(IL21 rabbit polyclonal antibody. Western Blot analysis of IL21 expression in human liver.)

Western Blot (WB) (IL21 rabbit polyclonal antibody. Western Blot analysis of IL21 expression in human liver.)

Western Blot (WB)

(IL21 rabbit polyclonal antibody. Western Blot analysis of IL21 expression in mouse kidney.)

Western Blot (WB) (IL21 rabbit polyclonal antibody. Western Blot analysis of IL21 expression in mouse kidney.)

Western Blot (WB)

(IL21 rabbit polyclonal antibody. Western Blot analysis of IL21 expression in A-431.)

Western Blot (WB) (IL21 rabbit polyclonal antibody. Western Blot analysis of IL21 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of IL21 expression in transfected 293T cell line by IL21 polyclonal antibody. Lane 1: IL21 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IL21 expression in transfected 293T cell line by IL21 polyclonal antibody. Lane 1: IL21 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between IL21 and DGKA. HeLa cells were stained with IL21 rabbit purified polyclonal 1:1200 and DGKA mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between IL21 and DGKA. HeLa cells were stained with IL21 rabbit purified polyclonal 1:1200 and DGKA mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)
Related Product Information for anti-IL21 antibody
Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B-and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
Product Categories/Family for anti-IL21 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,923 Da
NCBI Official Full Name
interleukin-21 isoform 1
NCBI Official Synonym Full Names
interleukin 21
NCBI Official Symbol
IL21
NCBI Official Synonym Symbols
Za11; IL-21
NCBI Protein Information
interleukin-21; OTTHUMP00000164088; interleukin-21 isoform
UniProt Protein Name
Interleukin-21
Protein Family
UniProt Gene Name
IL21
UniProt Synonym Gene Names
IL-21
UniProt Entry Name
IL21_HUMAN

NCBI Description

This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

IL21: Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation. Belongs to the IL-15/IL-21 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Secreted, signal peptide; Secreted; Cytokine; Cell development/differentiation

Chromosomal Location of Human Ortholog: 4q26-q27

Cellular Component: extracellular space

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor binding; interleukin-2 receptor binding; cytokine activity

Biological Process: positive regulation of interleukin-17 production; positive regulation of natural killer cell cytokine production; cell maturation; signal transduction; positive regulation of natural killer cell mediated cytotoxicity; positive regulation of interleukin-10 production; positive regulation of tyrosine phosphorylation of Stat3 protein; positive regulation of natural killer cell differentiation; positive regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of tissue remodeling; positive regulation of cell proliferation; positive regulation of B cell proliferation; positive regulation of T cell proliferation; immune response; positive regulation of interferon-gamma biosynthetic process; positive regulation of inflammatory response

Disease: Immunodeficiency, Common Variable, 11

Research Articles on IL21

Similar Products

Product Notes

The IL21 il21 (Catalog #AAA6382721) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL21 (Interleukin-21, IL-21, Za11, Interleukin21) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IL21 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL21 il21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.