Western Blot (WB)
(IL1B rabbit polyclonal antibody. Western Blot analysis of IL1B expression in mouse testis.)
Rabbit anti-Human, Mouse IL1B Polyclonal Antibody | anti-IL1B antibody
IL1B (Interleukin-1 beta, IL-1 beta, Catabolin, IL1F2) APC
Gene Names
IL1B; IL-1; IL1F2; IL1-BETA
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL1B; Polyclonal Antibody; IL1B (Interleukin-1 beta; IL-1 beta; Catabolin; IL1F2) APC; anti-IL1B antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IL1B. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-IL1B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human L1B, aa1-269 (AAH08678.1).
Immunogen Sequence
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(IL1B rabbit polyclonal antibody. Western Blot analysis of IL1B expression in mouse testis.)
Western Blot (WB)
(IL1B rabbit polyclonal antibody. Western Blot analysis of IL1B expression in mouse testis.)
Western Blot (WB)
(Western Blot analysis of IL1B expression in transfected 293T cell line by IL1B polyclonal antibody. Lane 1: IL1B transfected lysate (30.7kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of IL1B expression in transfected 293T cell line by IL1B polyclonal antibody. Lane 1: IL1B transfected lysate (30.7kD). Lane 2: Non-transfected lysate.)
Testing Data
(Proximity Ligation Analysis (PLA) of protein-protein interactions between IL1B and A2M. HeLa cells were stained with IL1B rabbit purified polyclonal 1:1200 and A2M mouse monoclonal antibody 1:50. Signals were detected (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Testing Data
(Proximity Ligation Analysis (PLA) of protein-protein interactions between IL1B and A2M. HeLa cells were stained with IL1B rabbit purified polyclonal 1:1200 and A2M mouse monoclonal antibody 1:50. Signals were detected (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-IL1B antibody
IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.
Product Categories/Family for anti-IL1B antibody
References
1. Ginger Phenylpropanoids Inhibit IL-1{beta} and Prostanoid Secretion and Disrupt Arachidonate-Phospholipid Remodeling by Targeting Phospholipases A2. Nievergelt A, Marazzi J, Schoop R, Altmann KH, Gertsch J.J Immunol. 2011 Oct 15;187(8):4140-50. Epub 2011 Sep 9.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17.7kD
NCBI Official Full Name
Interleukin 1, beta
NCBI Official Synonym Full Names
interleukin 1, beta
NCBI Official Symbol
IL1B
NCBI Official Synonym Symbols
IL-1; IL1F2; IL1-BETA
NCBI Protein Information
interleukin-1 beta; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta
UniProt Protein Name
Interleukin-1 beta
Protein Family
UniProt Gene Name
IL1B
UniProt Synonym Gene Names
IL1F2; IL-1 beta
UniProt Entry Name
IL1B_HUMAN
NCBI Description
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008]
Research Articles on IL1B
Similar Products
Product Notes
The IL1B il1b (Catalog #AAA6382674) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL1B (Interleukin-1 beta, IL-1 beta, Catabolin, IL1F2) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IL1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL1B il1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
