Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL18RAP Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Rabbit anti-Human IL18RAP Polyclonal Antibody | anti-IL18RAP antibody

IL18RAP antibody - N-terminal region

Gene Names
IL18RAP; ACPL; CD218b; IL-1R7; IL18RB; CDw218b; IL-1R-7; IL-18RAcP; IL-1RAcPL; IL-18Rbeta; IL-18R-beta
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
IL18RAP; Polyclonal Antibody; IL18RAP antibody - N-terminal region; anti-IL18RAP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC
Sequence Length
599
Applicable Applications for anti-IL18RAP antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IL18RAP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL18RAP Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-IL18RAP Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-IL18RAP antibody
This is a rabbit polyclonal antibody against IL18RAP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IL18RAP is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18.The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
interleukin-18 receptor accessory protein
NCBI Official Synonym Full Names
interleukin 18 receptor accessory protein
NCBI Official Symbol
IL18RAP
NCBI Official Synonym Symbols
ACPL; CD218b; IL-1R7; IL18RB; CDw218b; IL-1R-7; IL-18RAcP; IL-1RAcPL; IL-18Rbeta; IL-18R-beta
NCBI Protein Information
interleukin-18 receptor accessory protein
UniProt Protein Name
Interleukin-18 receptor accessory protein
UniProt Gene Name
IL18RAP
UniProt Synonym Gene Names
IL1R7; IL-18 receptor accessory protein; IL-18RAcP; AcPL; IL-1RAcPL; IL-1R-7; IL-1R7; IL-18R-beta; IL-18Rbeta
UniProt Entry Name
I18RA_HUMAN

NCBI Description

The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor and plays a role in signaling by IL18. Mutations in this gene are associated with Crohn's disease and inflammatory bowel disease, and susceptibility to celiac disease and leprosy. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]

Uniprot Description

IL18RAP: Required for the high affinity binding of interleukin 18 (IL-18) to its receptor complex. Together with IL18R1 mediates IL-18-dependent activation of NF-kappa-B and JNK. Belongs to the interleukin-1 receptor family.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: integral to membrane

Molecular Function: receptor activity

Biological Process: cell surface receptor linked signal transduction; immune response; inflammatory response

Research Articles on IL18RAP

Similar Products

Product Notes

The IL18RAP il18rap (Catalog #AAA3206220) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL18RAP antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL18RAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL18RAP il18rap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NRLSPKQVPE HLPFMGSNDL SDVQWYQQPS NGDPLEDIRK SYPHIIQDKC. It is sometimes possible for the material contained within the vial of "IL18RAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.