Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human Cadherin 6 Monoclonal Antibody | anti-CDH6 antibody

Cadherin 6 (K-Cadherin, Kidney Cadherin, CDH6, Cadherin-6) (PE)

Gene Names
CDH6; CAD6; KCAD
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cadherin 6; Monoclonal Antibody; Cadherin 6 (K-Cadherin; Kidney Cadherin; CDH6; Cadherin-6) (PE); anti-CDH6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F2
Specificity
Recognizes human CDH6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CDH6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa513-612 from human CDH6 (NP_004923) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of CDH6 expression in transfected 293T cell line by CDH6 monoclonal antibody. Lane 1: CDH6 transfected lysate (73.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CDH6 expression in transfected 293T cell line by CDH6 monoclonal antibody. Lane 1: CDH6 transfected lysate (73.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of CDH6 over-expressed 293 cell line, cotransfected with CDH6 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDH6 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CDH6 over-expressed 293 cell line, cotransfected with CDH6 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDH6 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-CDH6 antibody
CDH6 is a type II classical cadherin from the cadherin superfamily. It is a calcium dependent cell-cell adhesion membrane glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. Strong transcriptional expression of the CDH6 gene has been observed in hepatocellular and renal carcinoma cell lines, suggesting a possible role in metastasis and invasion.
Product Categories/Family for anti-CDH6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73,864 Da
NCBI Official Full Name
cadherin-6 preproprotein
NCBI Official Synonym Full Names
cadherin 6, type 2, K-cadherin (fetal kidney)
NCBI Official Symbol
CDH6
NCBI Official Synonym Symbols
CAD6; KCAD
NCBI Protein Information
cadherin-6
UniProt Protein Name
Cadherin-6
Protein Family
UniProt Gene Name
CDH6
UniProt Synonym Gene Names
K-cadherin
UniProt Entry Name
CADH6_HUMAN

Similar Products

Product Notes

The CDH6 cdh6 (Catalog #AAA6156836) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Cadherin 6 (K-Cadherin, Kidney Cadherin, CDH6, Cadherin-6) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cadherin 6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDH6 cdh6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cadherin 6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.