Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL18 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIL18 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit IL18 Polyclonal Antibody | anti-IL18 antibody

IL18 antibody - C-terminal region

Gene Names
IL18; IGIF; IL-18; IL-1g; IL1F4
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL18; Polyclonal Antibody; IL18 antibody - C-terminal region; anti-IL18 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS
Sequence Length
193
Applicable Applications for anti-IL18 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human IL18
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL18 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIL18 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-IL18 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIL18 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-IL18 antibody
This is a rabbit polyclonal antibody against IL18. It was validated on Western Blot

Target Description: The protein encoded by this gene is a proinflammatory cytokine. This cytokine can induce the IFN-gamma production of T cells. The combination of this cytokine and IL12 has been shown to inhibit IL4 dependent IgE and IgG1 production, and enhance IgG2a production of B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.
Product Categories/Family for anti-IL18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
interleukin-18 isoform 1
NCBI Official Synonym Full Names
interleukin 18
NCBI Official Symbol
IL18
NCBI Official Synonym Symbols
IGIF; IL-18; IL-1g; IL1F4
NCBI Protein Information
interleukin-18
UniProt Protein Name
Interleukin-18
Protein Family
UniProt Gene Name
IL18
UniProt Synonym Gene Names
IGIF; IL1F4; IL-18; IFN-gamma-inducing factor; IL-1 gamma
UniProt Entry Name
IL18_HUMAN

NCBI Description

The protein encoded by this gene is a proinflammatory cytokine that augments natural killer cell activity in spleen cells, and stimulates interferon gamma production in T-helper type I cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2011]

Uniprot Description

IL18: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells. Belongs to the IL-1 family.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 11q22.2-q22.3

Cellular Component: extracellular space; extracellular region; cytosol

Molecular Function: protein binding; cytokine activity

Biological Process: positive regulation of granulocyte macrophage colony-stimulating factor production; positive regulation of NK T cell proliferation; natural killer cell activation; positive regulation of NF-kappaB import into nucleus; positive regulation of activated T cell proliferation; chemokine biosynthetic process; cell-cell signaling; lipopolysaccharide-mediated signaling pathway; granulocyte macrophage colony-stimulating factor biosynthetic process; angiogenesis; inflammatory response; regulation of cell adhesion; positive regulation of interleukin-17 production; positive regulation of natural killer cell proliferation; T-helper 1 type immune response; interleukin-2 biosynthetic process; T-helper 2 type immune response; MAPKKK cascade; interleukin-13 biosynthetic process; sleep; positive regulation of tissue remodeling; positive regulation of interferon-gamma production; interferon-gamma biosynthetic process; immune response; negative regulation of myoblast differentiation; positive regulation of inflammatory response

Research Articles on IL18

Similar Products

Product Notes

The IL18 il18 (Catalog #AAA3214928) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL18 antibody - C-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IL18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL18 il18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIFFQRSVPG HDNKMQFESS SYEGYFLACE KERDLFKLIL KKEDELGDRS. It is sometimes possible for the material contained within the vial of "IL18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.