Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-IL10RB Polyclonal Antibody)

Rabbit IL10RB Polyclonal Antibody | anti-IL10RB antibody

IL10RB Polyclonal Antibody

Gene Names
IL10RB; CRFB4; CRF2-4; D21S58; D21S66; CDW210B; IL-10R2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
IL10RB; Polyclonal Antibody; IL10RB Polyclonal Antibody; CDW210B; CRF2-4; CRFB4; D21S58; D21S66; IL-10R2; interleukin-10 receptor subunit beta; anti-IL10RB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.59 mg/ml (varies by lot)
Sequence Length
325
Applicable Applications for anti-IL10RB antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-220 of human IL10RB (NP_000619.3).
Immunogen Sequence
MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS
Positive Samples
U-87MG, 293T, Jurkat, Mouse Skeletal Muscle, Rat Heart, Rat Liver
Cellular Location
Membrane, Single-Pass Type I Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-IL10RB Polyclonal Antibody)

Western Blot (WB) (Western blot-IL10RB Polyclonal Antibody)
Related Product Information for anti-IL10RB antibody
The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 36kDa
Observed: 36kDa
NCBI Official Full Name
interleukin 10 receptor, beta, isoform CRA_b
NCBI Official Synonym Full Names
interleukin 10 receptor subunit beta
NCBI Official Symbol
IL10RB
NCBI Official Synonym Symbols
CRFB4; CRF2-4; D21S58; D21S66; CDW210B; IL-10R2
NCBI Protein Information
interleukin-10 receptor subunit beta
UniProt Protein Name
Interleukin-10 receptor subunit beta
Protein Family
UniProt Gene Name
IL10RB
UniProt Synonym Gene Names
CRFB4; D21S58; D21S66; IL-10 receptor subunit beta; IL-10R subunit beta; IL-10RB; CRF2-4; IL-10R subunit 2; IL-10R2
UniProt Entry Name
I10R2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21. [provided by RefSeq, Jul 2008]

Uniprot Description

IL10RB: Shared cell surface receptor required for the activation of five class 2 cytokines: IL10, IL22, IL26, IL28, and IL29. Defects in IL10RB are the cause of inflammatory bowel disease type 25 (IBD25). It is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints. Belongs to the type II cytokine receptor family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: plasma membrane; integral to membrane; interleukin-28 receptor complex

Molecular Function: protein binding; interleukin-10 receptor activity; receptor activity

Biological Process: cytokine and chemokine mediated signaling pathway; immune response; signal transduction; inflammatory response; defense response to virus

Disease: Inflammatory Bowel Disease 25, Autosomal Recessive; Hepatitis B Virus, Susceptibility To

Research Articles on IL10RB

Similar Products

Product Notes

The IL10RB il10rb (Catalog #AAA9140421) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL10RB Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IL10RB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the IL10RB il10rb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL10RB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.