Western Blot (WB)
(WB Suggested Anti-IKBKE AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIKBKE is supported by BioGPS gene expression data to be expressed in HeLa)
Rabbit IKBKE Polyclonal Antibody | anti-IKBKE antibody
IKBKE antibody - N-terminal region
Gene Names
IKBKE; IKKE; IKKI; IKK-E; IKK-i
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IKBKE; Polyclonal Antibody; IKBKE antibody - N-terminal region; anti-IKBKE antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKC
Sequence Length
631
Applicable Applications for anti-IKBKE antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-IKBKE AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIKBKE is supported by BioGPS gene expression data to be expressed in HeLa)
Western Blot (WB)
(WB Suggested Anti-IKBKE AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIKBKE is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-IKBKE antibody
This is a rabbit polyclonal antibody against IKBKE. It was validated on Western Blot
Target Description: IKBKE is a noncanonical I-kappa-B kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines.
Target Description: IKBKE is a noncanonical I-kappa-B kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines.
Product Categories/Family for anti-IKBKE antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
69kDa
NCBI Official Full Name
inhibitor of nuclear factor kappa-B kinase subunit epsilon isoform 3
NCBI Official Synonym Full Names
inhibitor of nuclear factor kappa B kinase subunit epsilon
NCBI Official Symbol
IKBKE
NCBI Official Synonym Symbols
IKKE; IKKI; IKK-E; IKK-i
NCBI Protein Information
inhibitor of nuclear factor kappa-B kinase subunit epsilon
Protein Family
NCBI Description
IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 [PubMed 19481526]).[supplied by OMIM, Oct 2009]
Research Articles on IKBKE
Similar Products
Product Notes
The IKBKE (Catalog #AAA3215916) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IKBKE antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IKBKE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IKBKE for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGAIAGAQRR ENGPLEWSYT LPITCQLSLG LQSQLVPILA NILEVEQAKC. It is sometimes possible for the material contained within the vial of "IKBKE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
