Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using IGF1R antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit IGF1R Polyclonal Antibody | anti-IGF1R antibody

IGF1R Rabbit pAb

Gene Names
IGF1R; IGFR; CD221; IGFIR; JTK13
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
IGF1R; Polyclonal Antibody; IGF1R Rabbit pAb; CD221; IGFIR; IGFR; JTK13; anti-IGF1R antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
DVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIH
Applicable Applications for anti-IGF1R antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 741-935 of human IGF1R (NP_000866.1).
Positive Samples
Mouse brain, Mouse kidney, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using IGF1R antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using IGF1R antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-IGF1R antibody
Background: This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
154,793 Da
NCBI Official Full Name
insulin-like growth factor 1 receptor
NCBI Official Synonym Full Names
insulin-like growth factor 1 receptor
NCBI Official Symbol
IGF1R
NCBI Official Synonym Symbols
IGFR; CD221; IGFIR; JTK13
NCBI Protein Information
insulin-like growth factor 1 receptor; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; insulin-like growth factor I receptor
UniProt Protein Name
Insulin-like growth factor 1 receptor
UniProt Gene Name
IGF1R
UniProt Synonym Gene Names
IGF-I receptor
UniProt Entry Name
IGF1R_HUMAN

NCBI Description

This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. [provided by RefSeq, Jul 2008]

Uniprot Description

IGF1R: a receptor tyrosine kinase that binds insulin-like growth factor 1 (IGF1) with a high affinity and IGF2 with a lower affinity. Functions as an anti-apoptotic agent by enhancing cell survival. Can play a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. Tetramer of 2 alpha and 2 beta chains linked by disulfide bonds. The alpha chains contribute to the formation of the ligand- binding domain, while the beta chain carries the kinase domain. Interacts with PIK3R1 and with the PTB/PID domains of IRS1 and SHC1 in vitro when autophosphorylated on tyrosine residues. Mutated in rare cases of pre- and post-natal growth retardation. One SNP associated with increased human longevity. Increased expression of IGF1R and other pathway members associated with progression and malignancy in a range of cancers. Inhibitors: AG1024, AEW541.

Protein type: Membrane protein, integral; Protein kinase, tyrosine (receptor); Kinase, protein; Protein kinase, TK; EC 2.7.10.1; TK group; InsR family

Chromosomal Location of Human Ortholog: 15q26.3

Cellular Component: neuron projection; intracellular membrane-bound organelle; membrane; integral to plasma membrane; plasma membrane; caveola; receptor complex

Molecular Function: insulin binding; identical protein binding; insulin-like growth factor binding; protein binding; insulin-like growth factor I binding; protein-tyrosine kinase activity; insulin receptor substrate binding; G-protein alpha-subunit binding; phosphoinositide 3-kinase binding; insulin-like growth factor receptor activity; insulin receptor binding; ATP binding

Biological Process: phosphoinositide 3-kinase cascade; epidermis development; inactivation of MAPKK activity; protein heterooligomerization; protein amino acid autophosphorylation; exocrine pancreas development; signal transduction; regulation of JNK cascade; response to vitamin E; mammary gland development; positive regulation of MAPKKK cascade; male sex determination; positive regulation of cell proliferation; protein tetramerization; positive regulation of cytokinesis; phosphoinositide-mediated signaling; negative regulation of protein kinase B signaling cascade; positive regulation of mitosis; negative regulation of transcription factor activity; positive regulation of protein kinase B signaling cascade; axonogenesis; insulin-like growth factor receptor signaling pathway; establishment of cell polarity; insulin receptor signaling pathway; immune response; brain development; positive regulation of DNA replication; positive regulation of cell migration; negative regulation of apoptosis

Disease: Insulin-like Growth Factor I, Resistance To

Research Articles on IGF1R

Similar Products

Product Notes

The IGF1R igf1r (Catalog #AAA9142500) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGF1R Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IGF1R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:100 IF: 1:50-1:100. Researchers should empirically determine the suitability of the IGF1R igf1r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DVMQVANTTM SSRSRNTTAA DTYNITDPEE LETEYPFFES RVDNKERTVI SNLRPFTLYR IDIHSCNHEA EKLGCSASNF VFARTMPAEG ADDIPGPVTW EPRPENSIFL KWPEPENPNG LILMYEIKYG SQVEDQRECV SRQEYRKYGG AKLNRLNPGN YTARIQATSL SGNGSWTDPV FFYVQAKTGY ENFIH. It is sometimes possible for the material contained within the vial of "IGF1R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.