Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-IFNB1 Polyclonal Antibody)

Rabbit anti-Human, Mouse IFNB1 Polyclonal Antibody | anti-IFNB1 antibody

IFNB1 Polyclonal Antibody

Gene Names
IFNB1; IFB; IFF; IFNB; IFN-beta
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
IFNB1; Polyclonal Antibody; IFNB1 Polyclonal Antibody; IFB; IFF; IFN-beta; IFNB; interferon beta; anti-IFNB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.2 mg/ml (varies by lot)
Sequence Length
187
Applicable Applications for anti-IFNB1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 30-187 of human IFNB1 (NP_002167.1).
Immunogen Sequence
LQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Positive Samples
A-549, A-431, Mouse Liver, Mouse Small Intestine
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-IFNB1 Polyclonal Antibody)

Western Blot (WB) (Western blot-IFNB1 Polyclonal Antibody)
Related Product Information for anti-IFNB1 antibody
This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are important for defense against viral infections. In addition, type I interferons are involved in cell differentiation and anti-tumor defenses. Following secretion in response to a pathogen, type I interferons bind a homologous receptor complex and induce transcription of genes such as those encoding inflammatory cytokines and chemokines. Overactivation of type I interferon secretion is linked to autoimmune diseases. Mice deficient for this gene display several phenotypes including defects in B cell maturation and increased susceptibility to viral infection.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 22kDa
Observed: 22kDa
NCBI Official Full Name
interferon beta
NCBI Official Synonym Full Names
interferon beta 1
NCBI Official Symbol
IFNB1
NCBI Official Synonym Symbols
IFB; IFF; IFNB; IFN-beta
NCBI Protein Information
interferon beta
UniProt Protein Name
Interferon beta
Protein Family
UniProt Gene Name
IFNB1
UniProt Synonym Gene Names
IFB; IFNB; IFN-beta
UniProt Entry Name
IFNB_HUMAN

NCBI Description

This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are important for defense against viral infections. In addition, type I interferons are involved in cell differentiation and anti-tumor defenses. Following secretion in response to a pathogen, type I interferons bind a homologous receptor complex and induce transcription of genes such as those encoding inflammatory cytokines and chemokines. Overactivation of type I interferon secretion is linked to autoimmune diseases. Mice deficient for this gene display several phenotypes including defects in B cell maturation and increased susceptibility to viral infection. [provided by RefSeq, Sep 2015]

Uniprot Description

IFNB1: Has antiviral, antibacterial and anticancer activities. Belongs to the alpha/beta interferon family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 9p21

Cellular Component: extracellular space; extracellular region

Molecular Function: interferon-alpha/beta receptor binding; cytokine activity

Biological Process: B cell proliferation; adaptive immune response; cytokine and chemokine mediated signaling pathway; response to virus; regulation of MHC class I biosynthetic process; natural killer cell activation; negative regulation of T cell differentiation; humoral immune response; T cell activation during immune response; cell surface receptor linked signal transduction; response to exogenous dsRNA; negative regulation of viral genome replication; B cell differentiation; defense response to bacterium; positive regulation of innate immune response; natural killer cell activation during immune response; innate immune response; positive regulation of transcription from RNA polymerase II promoter; blood coagulation; defense response to virus; positive regulation of peptidyl-serine phosphorylation of STAT protein; B cell activation during immune response

Research Articles on IFNB1

Similar Products

Product Notes

The IFNB1 ifnb1 (Catalog #AAA9140784) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNB1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IFNB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the IFNB1 ifnb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFNB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.