Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IFIT3 antibody Titration: 1 ug/mLSample Type: Human 293T Whole Cell)

Rabbit anti-Human IFIT3 Polyclonal Antibody | anti-IFIT3 antibody

IFIT3 Antibody - C-terminal region

Gene Names
IFIT3; P60; IRG2; IFI60; IFIT4; ISG60; RIG-G; cig41; CIG-49; GARG-49
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IFIT3; Polyclonal Antibody; IFIT3 Antibody - C-terminal region; anti-IFIT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQNGDLL
Sequence Length
490
Applicable Applications for anti-IFIT3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFIT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IFIT3 antibody Titration: 1 ug/mLSample Type: Human 293T Whole Cell)

Western Blot (WB) (WB Suggested Anti-IFIT3 antibody Titration: 1 ug/mLSample Type: Human 293T Whole Cell)
Related Product Information for anti-IFIT3 antibody
This is a rabbit polyclonal antibody against IFIT3. It was validated on Western Blot

Target Description: IFIT3 is a IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. It enhances MAVS- mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. It exihibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin- dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2.
Product Categories/Family for anti-IFIT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
interferon-induced protein with tetratricopeptide repeats 3 isoform a
NCBI Official Synonym Full Names
interferon induced protein with tetratricopeptide repeats 3
NCBI Official Symbol
IFIT3
NCBI Official Synonym Symbols
P60; IRG2; IFI60; IFIT4; ISG60; RIG-G; cig41; CIG-49; GARG-49
NCBI Protein Information
interferon-induced protein with tetratricopeptide repeats 3
UniProt Protein Name
Interferon-induced protein with tetratricopeptide repeats 3
UniProt Gene Name
IFIT3
UniProt Synonym Gene Names
CIG-49; IFI60; IFIT4; ISG60; IFIT-3; IFI-60K; IFIT-4; P60; RIG-G
UniProt Entry Name
IFIT3_HUMAN

Uniprot Description

IFIT3: IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS- mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exihibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin- dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2. Belongs to the IFIT family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: mitochondrion; cytoplasm; cytosol

Molecular Function: identical protein binding; protein binding

Biological Process: negative regulation of cell proliferation; cytokine and chemokine mediated signaling pathway; response to virus; defense response to virus; negative regulation of apoptosis

Research Articles on IFIT3

Similar Products

Product Notes

The IFIT3 ifit3 (Catalog #AAA3220299) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFIT3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFIT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IFIT3 ifit3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEGLSISKKS TDKEEIKDQP QNVSENLLPQ NAPNYWYLQG LIHKQNGDLL. It is sometimes possible for the material contained within the vial of "IFIT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.