Western Blot (WB)
(WB Suggested Anti-IDO2 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole Cell)
Rabbit IDO2 Polyclonal Antibody | anti-IDO2 antibody
IDO2 antibody - N-terminal region
Gene Names
IDO2; INDOL1
Reactivity
Cow, Dog, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IDO2; Polyclonal Antibody; IDO2 antibody - N-terminal region; anti-IDO2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSF
Sequence Length
420
Applicable Applications for anti-IDO2 antibody
Western Blot (WB)
Homology
Cow: 83%; Dog: 83%; Human: 100%; Mouse: 83%; Rabbit: 83%; Rat: 83%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-IDO2 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-IDO2 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole Cell)
Related Product Information for anti-IDO2 antibody
This is a rabbit polyclonal antibody against IDO2. It was validated on Western Blot
Target Description: Along with the enzymes encoded by the INDO and TDO2 genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway.
Target Description: Along with the enzymes encoded by the INDO and TDO2 genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway.
Product Categories/Family for anti-IDO2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47kDa
NCBI Official Full Name
indoleamine 2,3-dioxygenase 2
NCBI Official Synonym Full Names
indoleamine 2,3-dioxygenase 2
NCBI Official Symbol
IDO2
NCBI Official Synonym Symbols
INDOL1
NCBI Protein Information
indoleamine 2,3-dioxygenase 2
Protein Family
NCBI Description
Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway (Ball et al., 2007 [PubMed 17499941]).[supplied by OMIM, Feb 2011]
Research Articles on IDO2
Similar Products
Product Notes
The IDO2 (Catalog #AAA3216532) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IDO2 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IDO2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IDO2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YRPWMEIANK LPQLIDAHQL QAHVDKMPLL SCQFLKGHRE QRLAHLVLSF. It is sometimes possible for the material contained within the vial of "IDO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
