Rabbit anti-Human ICOS Polyclonal Antibody | anti-ICOS antibody

ICOS (Inducible T-cell Costimulator, Activation Inducible Lymphocyte Immunomediatory Molecule, AILIM, CD278, CD278 Antigen, MGC39850) (PE)

Cat. Num. AAA6382001

• Gene Names: ICOS; AILIM; CD278; CVID1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ICOS; Polyclonal Antibody; ICOS (Inducible T-cell Costimulator; Activation Inducible Lymphocyte Immunomediatory Molecule; AILIM; CD278; CD278 Antigen; MGC39850) (PE); anti-ICOS antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ICOS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ICOS antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ICOS, aa1-218 (NP_036224.1).
• Immunogen Sequence: MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ICOS rabbit polyclonal antibody. Western Blot analysis of ICOS expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of ICOS expression in transfected 293T cell line by ICOS polyclonal antibody. Lane 1: ICOS transfected lysate (22.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ICOS antibody

ICOS belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation.

Product Categories/Family for anti-ICOS antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 15029518
• NCBI GeneID: 29851
• NCBI Accession #: NP_036224.1
• NCBI GenBank Nucleotide #: NM_012092.2
• UniProt Accession #: Q9Y6W8; Q8N6W8
• Molecular Weight: 19,127 Da
• NCBI Official Full Name: inducible T-cell costimulator
• NCBI Official Synonym Full Names: inducible T cell costimulator
• NCBI Official Symbol: ICOS
• NCBI Official Synonym Symbols: AILIM; CD278; CVID1
• NCBI Protein Information: inducible T-cell costimulator
• UniProt Protein Name: Inducible T-cell costimulator
• Protein Family: ICOS ligand
• UniProt Gene Name: ICOS
• UniProt Synonym Gene Names: AILIM
• UniProt Entry Name: ICOS_HUMAN

NCBI Description

The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. [provided by RefSeq, Jul 2008]

Uniprot Description

ICOS: Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up- regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up- regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre- activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes. Defects in ICOS are the cause of immunodeficiency common variable type 1 (CVID1). CVID1 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be lo. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q33

Cellular Component: integral to plasma membrane; extracellular region; plasma membrane; external side of plasma membrane

Biological Process: cell-cell adhesion; T cell tolerance induction; T cell costimulation; immune response

Disease: Immunodeficiency, Common Variable, 2; Immunodeficiency, Common Variable, 1